Sequence 1: | NP_649184.1 | Gene: | Ssk / 40207 | FlyBaseID: | FBgn0036945 | Length: | 162 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285034.1 | Gene: | CG44325 / 31831 | FlyBaseID: | FBgn0265413 | Length: | 146 | Species: | Drosophila melanogaster |
Alignment Length: | 141 | Identity: | 36/141 - (25%) |
---|---|---|---|
Similarity: | 67/141 - (47%) | Gaps: | 24/141 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 IFIKALKLIINLVIIFLYRWGDGGEFLGIGGTWNLNEEKSADAEIVASGVMVGFLIYTGCHTIAF 74
Fly 75 AFGTTKHKGELCDTIMNVVGCIMWIAVGGVALHYWKGYMSDEGFLYVNSERQVGIAMGSLCVIEG 139
Fly 140 ALYLLDTVLAC 150 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR36692 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |