DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssk and nhr-13

DIOPT Version :9

Sequence 1:NP_649184.1 Gene:Ssk / 40207 FlyBaseID:FBgn0036945 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001024269.1 Gene:nhr-13 / 178696 WormBaseID:WBGene00003612 Length:425 Species:Caenorhabditis elegans


Alignment Length:139 Identity:24/139 - (17%)
Similarity:56/139 - (40%) Gaps:37/139 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SIFIKALKLIINLVI---IFLYRWG-DGGEFLGIGGTW-------------NLNEEKSADAEIVA 56
            |:|...|...::.||   .:.|:.| :..|.:...||:             |.|....:..:::.
 Worm   229 SVFCYRLVCAVDFVINSAYYTYKRGIEHNELVLSDGTFIPMVPTPLTGYEENANLLFQSQDDLMK 293

  Fly    57 SGVMVGFLIYTGCHTIAFAFGTTKHKGELCDTIMNVVGCIMWIAVGGVALHYWKGYMSDEGFLYV 121
            ...::..:::.....:.||.....|: |.|  ::..: |:..::       |::  :|::|    
 Worm   294 FRTLMPLILHQWETCVPFAQLAPSHE-EFC--LLKAI-CVWHVS-------YYR--LSEDG---- 341

  Fly   122 NSERQVGIA 130
               |::.||
 Worm   342 ---RRIAIA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SskNP_649184.1 None
nhr-13NP_001024269.1 ZnF_C4 21..79 CDD:197701
NR_LBD 198..382 CDD:132726 24/139 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S12566
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.