DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7328 and CG4686

DIOPT Version :10

Sequence 1:NP_649181.1 Gene:CG7328 / 40204 FlyBaseID:FBgn0036942 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_650837.1 Gene:CG4686 / 42361 FlyBaseID:FBgn0038739 Length:181 Species:Drosophila melanogaster


Alignment Length:67 Identity:17/67 - (25%)
Similarity:28/67 - (41%) Gaps:10/67 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 ANGNYYEMSS--YKQDKVVDTLGAGDSFMAGFIYATLKARRSLAEAV------DFANRVASHKIT 292
            ::|:.|.::.  |...::...:||...||..:....||......|.|      |.|||:  |.:.
  Fly    57 SHGSLYRLAGCHYHFIRLAGIVGASAIFMGAYCKYVLKDVSDPKEQVDSQAFADVANRI--HFLH 119

  Fly   293 GF 294
            .|
  Fly   120 SF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7328NP_649181.1 Ketohexokinase 6..297 CDD:238914 17/67 (25%)
CG4686NP_650837.1 ribokinase_pfkB_like <24..114 CDD:469648 13/56 (23%)
DUF423 85..169 CDD:461234 11/39 (28%)

Return to query results.
Submit another query.