DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7328 and CG2794

DIOPT Version :10

Sequence 1:NP_649181.1 Gene:CG7328 / 40204 FlyBaseID:FBgn0036942 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_608533.1 Gene:CG2794 / 33233 FlyBaseID:FBgn0031265 Length:700 Species:Drosophila melanogaster


Alignment Length:30 Identity:17/30 - (56%)
Similarity:21/30 - (70%) Gaps:1/30 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 VVDTLGAGDSFMAGFIYATLKARRSLAEAV 280
            :|:..||||||.||||.|.|:. |||.|.:
  Fly   628 IVNVSGAGDSFCAGFITALLRG-RSLDECI 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7328NP_649181.1 Ketohexokinase 6..297 CDD:238914 17/30 (57%)
CG2794NP_608533.1 Indigoidine_A 33..326 CDD:461231
YeiC_kinase_like 345..669 CDD:238916 17/30 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.