DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7335 and CG17010

DIOPT Version :10

Sequence 1:NP_649180.1 Gene:CG7335 / 40203 FlyBaseID:FBgn0036941 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_609560.2 Gene:CG17010 / 34650 FlyBaseID:FBgn0032424 Length:429 Species:Drosophila melanogaster


Alignment Length:159 Identity:43/159 - (27%)
Similarity:68/159 - (42%) Gaps:11/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KRHVLAVGSCTLDMITIV-DLPLFPGQVQRTTEGSWRRGGPAANICTVWRRLGLECEFLGVLSRV 93
            |..|:..|:..::.||.| :||. ||::...|......||..||.|....:||.....:..|.:.
  Fly     4 KLDVVVFGTANIEYITYVPELPK-PGELVAGTYMETCFGGKGANQCVAAAKLGASTVLVAKLGKD 67

  Fly    94 RAFESLLNGFQSQGIDISHCPLTNHRPAHRS-IIVQRNVDTRTMLEFANANQELTYQQFVGAVDY 157
            .:.:..||..|...:|::|.....:.|...| |.|..|.| :..:..|.||..||.:....|   
  Fly    68 ESGDDYLNHLQQHEVDVTHVQQVENNPTGMSEIAVSENGD-QYKINVAGANVFLTAKDVTRA--- 128

  Fly   158 QKYSWIHFE---CRNPVEMLRMVLAVIQF 183
             |.|:...:   |:...:|...:.|:.||
  Fly   129 -KKSFQDAKVLLCQLETDMNATMCALRQF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7335NP_649180.1 Ketohexokinase 32..357 CDD:238914 42/157 (27%)
CG17010NP_609560.2 ribokinase 6..301 CDD:238579 42/157 (27%)

Return to query results.
Submit another query.