DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-J and CG13837

DIOPT Version :10

Sequence 1:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster


Alignment Length:191 Identity:46/191 - (24%)
Similarity:62/191 - (32%) Gaps:41/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SDCTRYRQCLEGGSFAVAKCSVGNYFDPARRACL----------PVAISAAHQCSCVLPDNAT-- 152
            |:|::|..|...|||. |:|..|:|:|.....||          ||.|:.........|....  
  Fly    41 SNCSKYIYCAGPGSFE-AECLDGHYYDEKLERCLDRKLVSRCRDPVGITTKSPSMVKKPAQKAEP 104

  Fly   153 -------LANPSDCETYFRCHSGQAELVQCPSGDYFDERVSSCVPDHTGICLEKPTMPPTLTEQA 210
                   |.|...|..|..|:.| |.|.:            :|.|.|...|....|....:    
  Fly   105 LAITLRLLPNAGPCYPYMVCYEG-AGLAK------------ACTPAHLVSCNRMQTRENII---- 152

  Fly   211 LAMDECIRTGSRLAPHSRDCQRYYICAKKRVLEMRCPRGQYFDVVRRYCALDLGSECQALQ 271
                .|........||.|:|..:|.|:....|..||.....:...||.|.......|.:.|
  Fly   153 ----NCQEGVYGFMPHPRNCAYFYYCSSGSKLVHRCHLNYTWHYERRSCVQQSERMCYSEQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696
CBM_14 145..192 CDD:426342 11/55 (20%)
CBM_14 216..259 CDD:426342 12/42 (29%)
CG13837NP_651113.1 CBM_14 36..81 CDD:426342 14/40 (35%)
CBM_14 154..203 CDD:426342 13/48 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.