DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-J and CG7248

DIOPT Version :9

Sequence 1:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster


Alignment Length:286 Identity:68/286 - (23%)
Similarity:107/286 - (37%) Gaps:69/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MLPHKDHCQRFYVCTGDDDMPFQEFNCPAEYHFSKKLMICVPGACTDESVFC----------GLT 92
            :||..::|..||:|..|..   :.:.||.|..|:..|.||    ...::|:|          ..|
  Fly   140 LLPSAENCNEFYLCVNDQS---KVYRCPGEMLFNPDLNIC----DDKDNVWCYGDRTTPDPLDTT 197

  Fly    93 NSVERV---------------QSDCTRYRQCLEGGSFAVAKCSVGNYFDPARRACLP-VAISAAH 141
            ...|..               ..:|.:|..|....|:.:..|.|.|:|:|....|.| :|..|..
  Fly   198 TPAEESFTKCEDQEKGTFFPDPENCQQYYYCWGNKSYTILPCPVDNWFNPISGNCGPDIAPDACR 262

  Fly   142 Q-------------CSCVLPDNA--TLANP-------------SDCETYFRC-HSGQAELVQCPS 177
            :             .:.|.|.:.  ::.||             |||::|..| ::|::...:|||
  Fly   263 ETTPTSTPTIDTSSSTTVAPTSTEDSVGNPCADQELGASFPIKSDCQSYLLCLNNGESTTAKCPS 327

  Fly   178 GDYFDERVSSCVPD-HTGICLEK-PTMPPTLTEQALAMDECI--RTGSRLAPHSRDCQRYYIC-A 237
            ..:||.:...|.|: ....|||. .|....:|.|| ..|.|.  ..|:.. |...:||:|.:| .
  Fly   328 NAWFDPKTGDCGPNVSPTACLESFETTTTAVTTQA-PKDPCADQELGTSY-PLVTNCQQYILCMG 390

  Fly   238 KKRVLEMRCPRGQYFDVVRRYCALDL 263
            ........|....:||.....|..|:
  Fly   391 NGESTVANCIYNSWFDPQTGNCGPDV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 13/38 (34%)
CBM_14 145..192 CDD:279884 17/63 (27%)
CBM_14 216..259 CDD:279884 10/45 (22%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884 14/48 (29%)
CBM_14 207..261 CDD:279884 12/53 (23%)
CBM_14 293..347 CDD:279884 13/53 (25%)
CBM_14 367..421 CDD:279884 12/51 (24%)
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D29657at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.