DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-J and CG4835

DIOPT Version :9

Sequence 1:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:336 Identity:67/336 - (19%)
Similarity:108/336 - (32%) Gaps:115/336 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DPWQMLPHKD--------HCQRFYVCTGDDDMPFQEFNCPAEYHFSKKLMIC------------- 77
            ||......||        :|..:.:|   .|...|..:||....|:..|::|             
  Fly   389 DPNDCKDEKDGTIFAYIGNCSEYLIC---KDNQVQMGHCPPNTLFNPDLLVCDEPDDVVCLGDRT 450

  Fly    78 -------VPGACTDESVFCGLTNSVERV------------------QSDCTRYRQCLEGGSFAVA 117
                   :|...|:::.....|.:|...                  ..||::|..||.||.:.:|
  Fly   451 TTPIPTTIPTTTTEKTTPTTTTTTVATTLGPDQLCDGQELGASFSYPDDCSKYYLCLGGGQWTLA 515

  Fly   118 KCSVGNYFDPARRACLP----------------------------------VAISAAHQCSCVLP 148
            .|..|:||||:...|.|                                  .|.:.....:.|.|
  Fly   516 PCIYGSYFDPSTGQCGPDVAPDACKPSQVTTTTTTTTTETTTTERNTTPKSTATTTERTTTTVAP 580

  Fly   149 ---------DNATLANPSDCETYFRCHSGQAELVQCPSGDYFDERVSSCVP---------DHTGI 195
                     :|..:|.|::|..|..|.|.......||.|.:|..::..|:.         |.:..
  Fly   581 KTGICGGRNENENIAYPNNCTKYIVCVSPIPIAFFCPDGTFFSSKLEKCIDDWDESDCEGDQSTT 645

  Fly   196 CLE----KPTMPPTLTEQALAMDECIRTGSRLAPHSRDCQRYYICAKKRVLEMR-CPRGQYFDVV 255
            .||    :|...||:         |..:.....|:..:||.:..|....:..|. |..|:|:|.:
  Fly   646 TLEPGYTRPPPEPTM---------CTNSSRDTFPYPDNCQWFIRCVDDYIYMMDVCNCGEYYDPI 701

  Fly   256 RRYCALDLGSE 266
            ...|..|:.|:
  Fly   702 TEKCGADVPSD 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 11/66 (17%)
CBM_14 145..192 CDD:279884 14/64 (22%)
CBM_14 216..259 CDD:279884 10/43 (23%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884 11/53 (21%)
CBM_14 485..539 CDD:279884 16/53 (30%)
CBM_14 585..638 CDD:279884 12/52 (23%)
CBM_14 661..714 CDD:279884 13/52 (25%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444104
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D29657at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.