DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-J and obst-E

DIOPT Version :9

Sequence 1:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:233 Identity:58/233 - (24%)
Similarity:82/233 - (35%) Gaps:28/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MICVP--GACTDESVFCGLTNSVERVQSDCTRYRQCLEGGSFAVAK-CSVGNYFDPARRA---CL 133
            ::||.  |:....|..|...|........|..|.:|.:|  ..|.| |..|..|....:|   |.
  Fly     9 LLCVAMFGSMALGSPECPTPNGRFASGDQCDSYTECQDG--TPVEKLCPDGLLFHQRTKATGECT 71

  Fly   134 PVAISAAHQCSCVLPDNATLANP-----------SDCETYFRCHSGQAELVQCPSGDYFDERVSS 187
            ....|...:.:.:.|.|.|...|           :.|..|..|..|.|.|.:||.|..|:|....
  Fly    72 YAPYSTCKERARLQPANGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQ 136

  Fly   188 C-VPDHTGIC-------LEKPTMPPTLTEQALAMDECIRTGSRLAPHSRDCQRYYICAKKRVLEM 244
            | .||....|       ...|.........|.|:|.......|...|.:.|::|::|........
  Fly   137 CDWPDLVESCNAEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLY 201

  Fly   245 RCPRGQYFDVVRRYCAL-DLGSECQALQAEKQDLELEE 281
            .|.:...|:...:.|.. :...||.||..|||.|:.|:
  Fly   202 NCGKYLAFNSQTKLCDFYNKVPECYALLKEKQRLKAEK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 1/3 (33%)
CBM_14 145..192 CDD:279884 17/58 (29%)
CBM_14 216..259 CDD:279884 7/42 (17%)
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 11/43 (26%)
CBM_14 95..146 CDD:307643 14/50 (28%)
CBM_14 180..225 CDD:307643 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.