DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-J and LOC1279248

DIOPT Version :10

Sequence 1:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_318942.4 Gene:LOC1279248 / 1279248 VectorBaseID:AGAMI1_001027 Length:89 Species:Anopheles gambiae


Alignment Length:30 Identity:9/30 - (30%)
Similarity:15/30 - (50%) Gaps:8/30 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YFNVMILGPT--------QSPYEGGVFKLE 57
            :|:||:||.:        ||......||::
Mosquito   111 HFSVMMLGVSFIILYENRQSQISTVKFKIQ 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 7/26 (27%)
CBM_14 145..192 CDD:426342
CBM_14 216..259 CDD:426342
LOC1279248XP_318942.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.