DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76b and Ir92a

DIOPT Version :10

Sequence 1:NP_649176.1 Gene:Ir76b / 40198 FlyBaseID:FBgn0036937 Length:636 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:226 Identity:44/226 - (19%)
Similarity:82/226 - (36%) Gaps:55/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 LAPFEFWVWILILVSLLAVGPIIYALIILRNRLTGDGQQTPY----SLGHCAWFVYGALMKQGST 262
            :.||....|::::.:|:..|..:|.:..:..||...|.|..:    .|......::...::|.|.
  Fly   377 IMPFNNRAWLVLISTLVICGTFLYFMKYVSYRLRYSGTQVKFHHSRKLEKSMLDIFALFIQQPSA 441

  Fly   263 -LSPIADSTRLLFATWWIFITILTSFYTANLTAFLTLSKFTLPYNTV------------------ 308
             ||....:.|...||.......|.:.|:..|.:.||...::.|.:|:                  
  Fly   442 PLSFDRFAPRFFLATILCATITLENIYSGQLKSMLTFPFYSAPVDTIEKWAQSGWKWSAPSIIWV 506

  Fly   309 -----NDILTK----------------NKHFVSMRGGGVEYAIRTTNESLSM---LNRMIQNNYA 349
                 :|:.|:                |..|:...|.|:|   |.::.|||:   ::.....|..
  Fly   507 HTVQSSDLETEQILARNFEVHDYSYLSNVSFMPNYGFGIE---RLSSGSLSVGDYVSTEALENRI 568

  Fly   350 VFSDETNDTYNLQNYVEKNGYVFVRDRPAIN 380
            |..|:....|.  ..|...|::.:   |.:|
  Fly   569 VLHDDLYFDYT--RAVSIRGWILM---PELN 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76bNP_649176.1 Lig_chan-Glu_bd 83..192 CDD:463166
Lig_chan 209..458 CDD:459656 42/219 (19%)
Ir92aNP_001097845.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.