DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76b and Ir76a

DIOPT Version :9

Sequence 1:NP_649176.1 Gene:Ir76b / 40198 FlyBaseID:FBgn0036937 Length:636 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster


Alignment Length:286 Identity:61/286 - (21%)
Similarity:107/286 - (37%) Gaps:75/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FDADAPVETLETINRKKPKLREM---------LDWIGGKHLRIATLEDFPLSYTEVLENGTRVGH 109
            |||.....|.||.:....|:|.:         .|:   |...:...|..||.|...:........
  Fly   199 FDAKGTKATWETQSAMSSKMRNLKGREVVIGIFDY---KPFMLLDYEKPPLYYDRFMNTTDVTID 260

  Fly   110 GVSFQIIDFLKKKFNFTYEVVVPQDNIIGSPSDFDRSLIEMVNSSTVDLAAAFIPSLSDQRS--- 171
            |...|::....:.:|.|.:|...:      |.|:....:   |:|...|....:    |:|:   
  Fly   261 GTDIQLMLIFCELYNCTIQVDTSE------PYDWGDIYL---NASGYGLVGMIL----DRRNDYG 312

  Fly   172 ----FVYYS-------TTTLDEGEWIMVMQRPRESASGSGLLAPFEFWVWILILVSL----LAVG 221
                :::|.       |..|.......::..|....|.:.||.||:|.:|:.:::.|    ||:|
  Fly   313 VGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNRLISWTLLLRPFQFVLWMCVMLCLLLESLALG 377

  Fly   222 PIIYALIILRNRLTGDGQQTPYSLGHCAWFV---YGALMKQGSTLSPIADST-----------RL 272
                        :|...:.:..:.|: :|..   :|.:    |||....:.:           .:
  Fly   378 ------------ITRRWEHSSVAAGN-SWISSLRFGCI----STLKLFVNQSTNYVTSSYALRTV 425

  Fly   273 LFATWWIFITILTSFYTANLTAFLTL 298
            |.|::.|.| |||:.|:..|.|.|||
  Fly   426 LVASYMIDI-ILTTVYSGGLAAILTL 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76bNP_649176.1 Periplasmic_Binding_Protein_Type_2 83..437 CDD:304360 52/248 (21%)
Ir76aNP_001097647.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.