DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76b and spp-22

DIOPT Version :9

Sequence 1:NP_649176.1 Gene:Ir76b / 40198 FlyBaseID:FBgn0036937 Length:636 Species:Drosophila melanogaster
Sequence 2:NP_001025004.2 Gene:spp-22 / 3565459 WormBaseID:WBGene00044283 Length:149 Species:Caenorhabditis elegans


Alignment Length:77 Identity:17/77 - (22%)
Similarity:27/77 - (35%) Gaps:28/77 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 RVGHGVSFQIIDFLKKKFNFTYEVVVPQDNIIGSPSDFDRSLIEMVNSSTVDLAAAFIPSLSDQR 170
            |..:||::..|. |||.|                        |||:.   :|..|.|.....|..
 Worm    59 RAVYGVNYDFIQ-LKKDF------------------------IEMIR---LDCEALFHERPEDIS 95

  Fly   171 SFVYYSTTTLDE 182
            ..:.:.||.:::
 Worm    96 ECIRFLTTKVEK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76bNP_649176.1 Periplasmic_Binding_Protein_Type_2 83..437 CDD:304360 17/77 (22%)
spp-22NP_001025004.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.