DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76b and Ir7a

DIOPT Version :9

Sequence 1:NP_649176.1 Gene:Ir76b / 40198 FlyBaseID:FBgn0036937 Length:636 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:428 Identity:89/428 - (20%)
Similarity:159/428 - (37%) Gaps:115/428 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GVSFQIIDFLKKKFNFTYEVVVP---------QDNIIGSPSDFDRSLIEMVNSSTVDLAAAFIPS 165
            |:..::|..|...|:|...:..|         :|:..|.   ||:.:|.  |||.  |..|...|
  Fly   249 GIDGELIKLLASIFDFRILLEEPCNKCLSPDIKDDCSGC---FDQVIIS--NSSI--LIGAMSGS 306

  Fly   166 LSDQRSFVYYSTTTLDEGEWIMVMQRPRESASGSGLLAPFEFWVWILILVSLLAVGPIIYALIIL 230
            ...:..|.:  |::..:...:.:|....:..:.:.|..||...||:.::||.|    ::..::.:
  Fly   307 HQHRSHFSF--TSSYHQSSLVFIMHMSSQFGAVAQLAVPFTVIVWLALVVSSL----LLVLVLWM 365

  Fly   231 RNRLT-GDGQQTPYSLGHCAWFVYGALMKQGSTLS----PIADSTRLLFATWWIFITILTSFYTA 290
            ||||. |......::|.     |...||  |:.|.    |.:...|:|:|.|.:.:.:|...|..
  Fly   366 RNRLVCGRSDLASHALQ-----VLTTLM--GNPLEARSLPRSSRLRILYAGWLLLVLVLRVVYQG 423

  Fly   291 NLTAFLTLSKFTLPYNTVNDILTKNKHFVSMRGGGVEYAIRTTNESLSMLNRMIQNNYAVFSDET 355
            .|     ...|.|||:  ..:.|:                         ::.:|::||.:.:.|.
  Fly   424 KL-----FDSFRLPYH--KPLPTE-------------------------ISELIRSNYTLINQEY 456

  Fly   356 NDTYNLQ-NYVEKNGYVFVRDR----------------PAINIMLYRDYLYRKTVSFSDEKVHCP 403
            .|.|..: ..:.:||   .:||                ..|..|.|.:.::..|...:..|.|. 
  Fly   457 LDYYPRELTVLTRNG---SKDRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSRLTHIKEHI- 517

  Fly   404 FAMAKEPFLKKKRTFAYPIGSNLSQLFDPELLHLVESGIVKHLSKRNLPSAEICPQDLGGTERQL 468
            |......:|::.        |.|...||.::..|:.:||:.:..:    ..:.|..      |:.
  Fly   518 FLYQMVIYLRRH--------SLLKFAFDRKIKQLLSAGIIGYFVR----EFDACQY------RKP 564

  Fly   469 RNGDLMMT----------YYIMLAGFATALAVFSTELM 496
            ...|..:|          |||.|...:.|:..|..||:
  Fly   565 FEEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILELL 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76bNP_649176.1 Periplasmic_Binding_Protein_Type_2 83..437 CDD:304360 74/357 (21%)
Ir7aNP_572406.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.