DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76b and GRIN3B

DIOPT Version :9

Sequence 1:NP_649176.1 Gene:Ir76b / 40198 FlyBaseID:FBgn0036937 Length:636 Species:Drosophila melanogaster
Sequence 2:NP_619635.1 Gene:GRIN3B / 116444 HGNCID:16768 Length:1043 Species:Homo sapiens


Alignment Length:442 Identity:91/442 - (20%)
Similarity:150/442 - (33%) Gaps:144/442 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LRIATLEDFPLSYTE------------------------------VLENGT------RVGHGVSF 113
            ||:.||.:.|..:..                              .|.||:      :..:|...
Human   417 LRVVTLLEHPFVFARDPDEDGQCPAGQLCLDPGTNDSATLDALFAALANGSAPRALRKCCYGYCI 481

  Fly   114 QIIDFLKKKFNFTYEVVVPQDNIIGSPSDFD-RSLIEMVNSSTVDLAAAFIPSLSDQRSFV---- 173
            .:::.|.:...|.:|:.:..|...|:..|.. ..|:..:.:....:|.... |::..||.|    
Human   482 DLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSF-SINSARSQVVDFT 545

  Fly   174 --YYSTTTLDEGEWIMVMQRPRESASGSG-LLAPFEFWVWILILVSLLAVGPIIYALII------ 229
              ::||:       :.:|.|.|::||..| .:.|..:..|:.:..:|     .:.||.:      
Human   546 SPFFSTS-------LGIMVRARDTASPIGAFMWPLHWSTWLGVFAAL-----HLTALFLTVYEWR 598

  Fly   230 ----LRNRLTGDGQQTPYSLGHCAWFVYGALMKQG-STLSPIADSTRLLFATWWIFITILTSFYT 289
                |..|  |..:.|.:|........|..|.::. |:.:|...:.|||...|.||..::.|.||
Human   599 SPYGLTPR--GRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYT 661

  Fly   290 ANLTA-------FLTLSKFTLP----------YNTVNDILTK---NKHFVSMRGGGVEYAIRTTN 334
            |||.|       |..||....|          :.||.:...:   .|.|..|......::..||.
Human   662 ANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAPTTP 726

  Fly   335 ESLSMLNRMIQNNYAVFSDETNDTYNLQNYVEKNGYVFVRDRPAINIMLYRDYLYRKTVSFSDEK 399
            ..::||              |:|...|.        .|:.|:..:      ||    .||...: 
Human   727 RGVAML--------------TSDPPKLN--------AFIMDKSLL------DY----EVSIDAD- 758

  Fly   400 VHCPFAMAKEPFLKKKRTFAYPIG--------SNLSQLFDP-------ELLH 436
              |......:||..:    .|.||        ||||:....       :|||
Human   759 --CKLLTVGKPFAIE----GYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLH 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76bNP_649176.1 Periplasmic_Binding_Protein_Type_2 83..437 CDD:304360 91/442 (21%)
GRIN3BNP_619635.1 PBP1_iGluR_NMDA_NR3 19..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 415..808 CDD:270438 91/442 (21%)
Lig_chan 576..842 CDD:278489 61/275 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.