DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and NUD1

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_015018.3 Gene:NUD1 / 854555 SGDID:S000005900 Length:851 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:56/261 - (21%)
Similarity:95/261 - (36%) Gaps:88/261 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DLEAVEQVRLRVISYTV---SLSRLSLFLPRLQSLDLSGSVLSSLRDLGY--------------- 164
            |||.::      :||.:   ||..||| ...||.::||.:.:.||..:|.               
Yeast   544 DLECLD------LSYNLLNTSLKFLSL-CHHLQEVNLSYNSIQSLEGIGSSRMKKLNLSNNEING 601

  Fly   165 ----------------GLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVH- 212
                            |.|.:..||:||..:......:.||.::||..:||      ||..:|. 
Yeast   602 IIDFEQLILTNNSVVGGWLTVEVLDLSNNNIIGVRNINCLPRLKVLNLNGN------PLVSIVES 660

  Fly   213 -------LRVL----------KARNNRISE--------LGLLSFLGMC---------PQLQEVEL 243
                   ||.|          |.:|.::.:        |.:|...|..         ..||.:|:
Yeast   661 SKMENGTLRALSIKNTGGALSKLQNYKLDDQFTFPYQNLKILKLDGFAQLSKWQKWPATLQILEI 725

  Fly   244 QGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGEPAPVE-----MEEATSPASSDLESGSETTAQR 303
            .|.....||.:.||.:.::.:|.:.:.|.....|..:.     ::|...| .::|::..:.|...
Yeast   726 NGGLASSLPRFSSLKSTNLYSLTIANVRDFTHLPVDLSKELPFLQELHLP-GNNLQNAHKLTKTL 789

  Fly   304 P 304
            |
Yeast   790 P 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 19/87 (22%)
leucine-rich repeat 146..168 CDD:275380 8/52 (15%)
LRR_4 168..209 CDD:289563 12/40 (30%)
leucine-rich repeat 169..190 CDD:275380 5/20 (25%)
leucine-rich repeat 191..212 CDD:275380 6/20 (30%)
leucine-rich repeat 213..237 CDD:275380 8/50 (16%)
NUD1NP_015018.3 LRR <440..662 CDD:227223 32/130 (25%)
leucine-rich repeat 522..544 CDD:275380 56/261 (21%)
leucine-rich repeat 545..567 CDD:275380 9/28 (32%)
PPP1R42 557..784 CDD:411060 49/234 (21%)
leucine-rich repeat 568..588 CDD:275380 7/19 (37%)
leucine-rich repeat 589..621 CDD:275380 1/31 (3%)
leucine-rich repeat 622..643 CDD:275380 5/20 (25%)
leucine-rich repeat 699..738 CDD:275380 9/38 (24%)
leucine-rich repeat 739..768 CDD:275380 4/28 (14%)
leucine-rich repeat 794..806 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.