DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and LRRCC1

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:XP_016869409.1 Gene:LRRCC1 / 85444 HGNCID:29373 Length:1046 Species:Homo sapiens


Alignment Length:268 Identity:67/268 - (25%)
Similarity:113/268 - (42%) Gaps:73/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SLSRLSLFLPRLQSLDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGN 199
            |:|.|||. ..|.:::|..:.:|.:..:.: :..|..||:|:..::..:|.:.|..:..|....|
Human    35 SISELSLD-STLHAVNLHCNNISKIEAIDH-IWNLQHLDLSSNQISRIEGLNTLTKLCTLNLSCN 97

  Fly   200 MIQRVDPLAELVHLRVLKARNNRISEL-GLLSFLGMCPQLQEVELQG------------------ 245
            :|.:|:.|.||::|..|....|.|.:| ||:...|:..:|:.::|..                  
Human    98 LITKVEGLEELINLTRLNVSYNHIDDLSGLIPLHGIKHKLRYIDLHSNRIDSIHHLLQCMVGLHF 162

  Fly   246 ------------NPVCRLP--------------LYRSLLARSVPTLQLLDGRVLNGEPAPVEMEE 284
                        |||||||              .||:::.:::|.|::||.:.:.||  ||.:.|
Human   163 LTNLILEKDGDDNPVCRLPGTSLNTVTLPSELRGYRAVILQTLPQLRILDCKNIFGE--PVNLTE 225

  Fly   285 ATSPASSDLE---------------SGSETTAQRP-NTAPAPEPVPIALNAAIRRQVSASSGSTP 333
            ..|.....||               |..|...:.| .|||..|.||:        :..||:.|..
Human   226 INSSQLQCLEGLLDNLVSSDSPLNISEDEIIDRMPVITAPIDELVPL--------EQFASTPSDA 282

  Fly   334 VAGSVLSL 341
            |..|.:|:
Human   283 VLTSFMSV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 11/56 (20%)
leucine-rich repeat 146..168 CDD:275380 3/21 (14%)
LRR_4 168..209 CDD:289563 11/40 (28%)
leucine-rich repeat 169..190 CDD:275380 6/20 (30%)
leucine-rich repeat 191..212 CDD:275380 7/20 (35%)
leucine-rich repeat 213..237 CDD:275380 8/24 (33%)
LRRCC1XP_016869409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.