DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and SDS22

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_012728.1 Gene:SDS22 / 853641 SGDID:S000001676 Length:338 Species:Saccharomyces cerevisiae


Alignment Length:216 Identity:49/216 - (22%)
Similarity:82/216 - (37%) Gaps:55/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLDLSGSV-----------LSSLRDLG 163
            ::.:...||||.:..|: ..||...:||.|.    .|::|:|.|:.           ||:|.::.
Yeast   128 IKNLENLTDLENLYFVQ-NSISKIENLSTLK----SLKNLELGGNKVHSIEPDSFEGLSNLEEIW 187

  Fly   164 YG------------LLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVL 216
            .|            |..|..|.|.:..|...:....|..:..|....|.|.:::.|.:.:.|..|
Yeast   188 LGKNSIPRLINLHPLKNLKILSIQSNKLKKIENLEELTNLEELYLSHNFITKIEGLEKNLKLTTL 252

  Fly   217 KARNNRISELGLL------------------SF------LGMCPQLQEVELQGNPV---CRLPLY 254
            ...:|:|:.|..|                  ||      |....:|:.:.|:|||:   .:....
Yeast   253 DVTSNKITSLENLNHLSNLTDIWASFNKIDQSFESLGENLSALSRLETIYLEGNPIQLENKTSYR 317

  Fly   255 RSLLARSVPTLQLLDGRVLNG 275
            |.|.....|:||.:|...:.|
Yeast   318 RKLTMNLPPSLQKIDATYIRG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 16/79 (20%)
leucine-rich repeat 146..168 CDD:275380 9/44 (20%)
LRR_4 168..209 CDD:289563 9/40 (23%)
leucine-rich repeat 169..190 CDD:275380 5/20 (25%)
leucine-rich repeat 191..212 CDD:275380 4/20 (20%)
leucine-rich repeat 213..237 CDD:275380 9/47 (19%)
SDS22NP_012728.1 inl_like_NEAT_1 <42..>174 CDD:411101 14/50 (28%)
leucine-rich repeat 44..67 CDD:275380
leucine-rich repeat 68..91 CDD:275380
leucine-rich repeat 92..114 CDD:275380
PPP1R42 112..332 CDD:411060 47/208 (23%)
leucine-rich repeat 115..136 CDD:275380 0/7 (0%)
leucine-rich repeat 137..158 CDD:275380 8/25 (32%)
leucine-rich repeat 159..182 CDD:275380 5/22 (23%)
leucine-rich repeat 183..204 CDD:275380 3/20 (15%)
leucine-rich repeat 205..248 CDD:275380 9/42 (21%)
leucine-rich repeat 249..270 CDD:275380 6/20 (30%)
leucine-rich repeat 271..294 CDD:275380 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.