DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and LRRIQ1

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:XP_011537119.1 Gene:LRRIQ1 / 84125 HGNCID:25708 Length:1760 Species:Homo sapiens


Alignment Length:161 Identity:45/161 - (27%)
Similarity:75/161 - (46%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNS 181
            ||:|.||...|                  ||.|.|.|:.||.|..| ..|:.|..|.:.:..:::
Human  1004 TDVEGVENCGL------------------LQILKLQGNYLSELPSL-ENLVLLRELHLDDNSIST 1049

  Fly   182 FDGTSG--LPAIRVLIADGNMIQRVDPLAELVHLRVLKARNNRISEL-GLLSFLGMCPQLQEVEL 243
            .:..|.  ||.::.:....|.:.::.||...|.|..|...:|.:|:| ..:.:...|..|.|:.|
Human  1050 VEAFSSYWLPLLQNITISQNSLTKIVPLFHFVSLEKLDVSHNCLSDLKSAIKWFDACYSLHELSL 1114

  Fly   244 QGNPVCRLPLYRSLLARSVPTLQLLDGRVLN 274
            .|||:.:...:|..|.:.:|.|::|:|.:||
Human  1115 TGNPLLQETNWRDSLLKVLPALRILNGNILN 1145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 16/58 (28%)
leucine-rich repeat 146..168 CDD:275380 10/21 (48%)
LRR_4 168..209 CDD:289563 8/42 (19%)
leucine-rich repeat 169..190 CDD:275380 4/22 (18%)
leucine-rich repeat 191..212 CDD:275380 3/20 (15%)
leucine-rich repeat 213..237 CDD:275380 6/24 (25%)
LRRIQ1XP_011537119.1 DUF4515 164..343 CDD:291649
LRR_4 818..856 CDD:289563
leucine-rich repeat 820..841 CDD:275380
leucine-rich repeat 842..862 CDD:275380
leucine-rich repeat 863..884 CDD:275380
leucine-rich repeat 885..920 CDD:275380
leucine-rich repeat 921..970 CDD:275380
LRR_RI <963..1095 CDD:238064 28/109 (26%)
leucine-rich repeat 971..992 CDD:275380
leucine-rich repeat 993..1014 CDD:275380 5/9 (56%)
leucine-rich repeat 1015..1036 CDD:275380 10/21 (48%)
LRR_8 1037..1091 CDD:290566 11/53 (21%)
leucine-rich repeat 1037..1060 CDD:275380 4/22 (18%)
leucine-rich repeat 1083..1108 CDD:275380 6/24 (25%)
leucine-rich repeat 1109..1135 CDD:275380 8/25 (32%)
IQ 1338..1354 CDD:197470
IQ 1394..1415 CDD:197470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.