DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and DRC3

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:XP_011522320.1 Gene:DRC3 / 83450 HGNCID:25384 Length:562 Species:Homo sapiens


Alignment Length:237 Identity:52/237 - (21%)
Similarity:94/237 - (39%) Gaps:38/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LLPVVLPQQGPEPTLDELLRRVTQRTDLEAVEQVRLR-VISYTVSLSRLSLFLPR---------- 145
            :|.:.:..|||:....:|.::          |.:..: |:|..:...|.:...|:          
Human    17 MLKLAVGDQGPQEEAGQLAKQ----------EGILFKDVLSLQLDFRRKTADEPKGEQDDGQEDS 71

  Fly   146 ---------------LQSLDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLI 195
                           |:.|.|..:::..:..| ..|..|..||:|...:.:.:|...|..:..|.
Human    72 QEDILRIDNLWQFENLRKLQLDNNIIEKIEGL-ENLAHLVWLDLSFNNIETIEGLDTLVNLEDLS 135

  Fly   196 ADGNMIQRVDPLAELVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLAR 260
            ...|.|.::|.|..||.|:||...||||..:..:.:|.....|:.:.|..||:.....|:..:..
Human   136 LFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICA 200

  Fly   261 SVPTLQLLDGRVLNGEPAPVEMEEATSPASSDLESGSETTAQ 302
            .:|.|..||.|.::...|.|.: ..:.|..:|..|..:..|:
Human   201 YLPDLMYLDYRRIDDHTASVSL-SVSQPCETDSSSPQKKLAE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 14/81 (17%)
leucine-rich repeat 146..168 CDD:275380 5/21 (24%)
LRR_4 168..209 CDD:289563 11/40 (28%)
leucine-rich repeat 169..190 CDD:275380 6/20 (30%)
leucine-rich repeat 191..212 CDD:275380 6/20 (30%)
leucine-rich repeat 213..237 CDD:275380 8/23 (35%)
DRC3XP_011522320.1 leucine-rich repeat 87..108 CDD:275378 5/21 (24%)
LRR_9 88..213 CDD:317038 35/125 (28%)
leucine-rich repeat 109..130 CDD:275378 6/20 (30%)
leucine-rich repeat 131..152 CDD:275378 6/20 (30%)
leucine-rich repeat 153..177 CDD:275378 8/23 (35%)
leucine-rich repeat 178..189 CDD:275378 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.