DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and AT5G19680

DIOPT Version :10

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_197469.1 Gene:AT5G19680 / 832088 AraportID:AT5G19680 Length:328 Species:Arabidopsis thaliana


Alignment Length:196 Identity:45/196 - (22%)
Similarity:87/196 - (44%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TLDELL---RRVTQRTDLEAVEQV--------RLRVISYTVSLSRL-SLFLPR------------ 145
            ||.||.   ..|.:..::|.:..:        ||||:....:.::| .|:|.|            
plant   133 TLKELYVSKNEVNKIMEIEHLHNLQILELGSNRLRVMENLENFTKLEELWLGRNRIKVVNLCGLK 197

  Fly   146 -LQSLDLSGSVLSSLRDLGY-GLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLA 208
             ::.:.|..:.|:|::  |: ..:.|..|.:|:.|::..:|.|.|..:|||....|.:..||.:.
plant   198 CIKKISLQSNRLTSMK--GFEECVALEELYLSHNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQ 260

  Fly   209 ELVHLRVLKARNNRISELGLL--SFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGR 271
            .|..|..|...:|:|..|..:  :..|...:|..:.|:.||..:...|.:.:.:..|.::.:|..
plant   261 NLTKLEDLWLNDNQIESLEAITEAVTGSKEKLTTIYLENNPCAKSSDYVAAVRQIFPNVEQIDSN 325

  Fly   272 V 272
            :
plant   326 L 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 leucine-rich repeat 146..168 CDD:275380 4/22 (18%)
PPP1R42 <169..271 CDD:455733 27/103 (26%)
leucine-rich repeat 169..190 CDD:275380 7/20 (35%)
leucine-rich repeat 191..212 CDD:275380 7/20 (35%)
leucine-rich repeat 213..237 CDD:275380 6/25 (24%)
AT5G19680NP_197469.1 leucine-rich repeat 19..38 CDD:275380
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..88 CDD:275380
leucine-rich repeat 89..110 CDD:275380
leucine-rich repeat 111..133 CDD:275380 45/196 (23%)
PPP1R42 121..308 CDD:455733 42/176 (24%)
leucine-rich repeat 134..155 CDD:275380 5/20 (25%)
leucine-rich repeat 156..177 CDD:275380 4/20 (20%)
leucine-rich repeat 178..198 CDD:275380 4/19 (21%)
leucine-rich repeat 199..220 CDD:275380 4/22 (18%)
leucine-rich repeat 221..242 CDD:275380 7/20 (35%)
leucine-rich repeat 243..264 CDD:275380 7/20 (35%)
leucine-rich repeat 265..291 CDD:275380 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.