DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and AIR9

DIOPT Version :10

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001324697.1 Gene:AIR9 / 818033 AraportID:AT2G34680 Length:1768 Species:Arabidopsis thaliana


Alignment Length:238 Identity:53/238 - (22%)
Similarity:97/238 - (40%) Gaps:54/238 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PEPTLDELLRRVTQRTDLEAVEQVRLRVISYTV-SLSRLSLFL-PRLQSLDLSGSVLSSLRDLGY 164
            ||.....|:  :..:.:::|.:.:||.:..:.: ||:...|.| |.|:.:.|..::||:|.    
plant   310 PESRDSRLI--ILPKVEVKAGDDMRLDLRGHRIRSLTSGGLHLSPNLEFVYLRDNLLSTLE---- 368

  Fly   165 GLLQLTRLDISNCGLNSFDGTSGLP-----AIRVLIADGNMIQRVDPLAELVHLRVLKARNNRIS 224
            |:..|.|:.:.:...|.|.|....|     .::.|...||.|..:..|.:|.:|..|....|::.
plant   369 GIEILNRVKVLDLSFNDFKGPGFEPLENCKMLQQLYLAGNQITSLASLPQLPNLEFLSVAQNKLK 433

  Fly   225 ELGLLS---------------------FLGMCPQLQEVELQGNPVCRLPLYRSLLARSV----PT 264
            .|.:.|                     :|   |.|:.:.::.||:.::   ..|.|.|:    ||
plant   434 SLAMASQPRLQVLAASKNKITTLKDFPYL---PVLEHLRVEENPLLKI---SHLEAASILLVGPT 492

  Fly   265 LQLLDGRVLNGEPAPVE----------MEEATSPASSDLESGS 297
            |:..:.|.|:.|...:.          :.|......|||.:.|
plant   493 LKKFNDRDLSREEVAIAKRYPPQTALCLREGWEFCKSDLAAES 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 leucine-rich repeat 146..168 CDD:275380 6/21 (29%)
PPP1R42 <169..271 CDD:455733 28/131 (21%)
leucine-rich repeat 169..190 CDD:275380 6/25 (24%)
leucine-rich repeat 191..212 CDD:275380 6/20 (30%)
leucine-rich repeat 213..237 CDD:275380 6/44 (14%)
AIR9NP_001324697.1 TraV <170..>236 CDD:450310
leucine-rich repeat 332..353 CDD:275380 6/20 (30%)
PPP1R42 333..>497 CDD:455733 40/173 (23%)
leucine-rich repeat 354..375 CDD:275380 7/24 (29%)
leucine-rich repeat 376..396 CDD:275380 4/19 (21%)
leucine-rich repeat 400..421 CDD:275380 6/20 (30%)
leucine-rich repeat 422..442 CDD:275380 5/19 (26%)
leucine-rich repeat 443..464 CDD:275380 1/23 (4%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.