Sequence 1: | NP_649175.1 | Gene: | CG14185 / 40197 | FlyBaseID: | FBgn0036936 | Length: | 402 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_078824.2 | Gene: | CEP97 / 79598 | HGNCID: | 26244 | Length: | 865 | Species: | Homo sapiens |
Alignment Length: | 241 | Identity: | 59/241 - (24%) |
---|---|---|---|
Similarity: | 104/241 - (43%) | Gaps: | 45/241 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 VAIAEEEQHLP----AFVHLLPVVLPQQGP----EPTLDELLRRVTQRTDLEAVEQVRLRVISYT 133
Fly 134 VSLSRL-------------SLFLP--------------RLQSLDLSGSVLSSLRDLGYGLLQLTR 171
Fly 172 LDISNCGLNSFDGTSGLPAIRVLIADGNMIQ--RVDPLAELVHLRVLKARNNRISELGLLSFLGM 234
Fly 235 CPQLQEVELQGNP-VCRLPL-----YRSLLARSVPTLQLLDGRVLN 274 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14185 | NP_649175.1 | LRR_8 | 144..201 | CDD:290566 | 15/70 (21%) |
leucine-rich repeat | 146..168 | CDD:275380 | 5/21 (24%) | ||
LRR_4 | 168..209 | CDD:289563 | 12/42 (29%) | ||
leucine-rich repeat | 169..190 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 191..212 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 213..237 | CDD:275380 | 8/23 (35%) | ||
CEP97 | NP_078824.2 | leucine-rich repeat | 17..37 | CDD:275380 | 5/19 (26%) |
LRR 1 | 37..58 | 5/20 (25%) | |||
leucine-rich repeat | 38..59 | CDD:275380 | 5/21 (24%) | ||
LRR 2 | 59..80 | 5/20 (25%) | |||
leucine-rich repeat | 60..81 | CDD:275380 | 4/20 (20%) | ||
LRR_8 | 63..114 | CDD:290566 | 10/50 (20%) | ||
LRR_RI | <78..200 | CDD:238064 | 29/122 (24%) | ||
LRR 3 | 81..102 | 3/20 (15%) | |||
leucine-rich repeat | 82..103 | CDD:275380 | 3/20 (15%) | ||
LRR_8 | 103..156 | CDD:290566 | 12/53 (23%) | ||
LRR 4 | 103..124 | 5/21 (24%) | |||
leucine-rich repeat | 104..125 | CDD:275380 | 5/21 (24%) | ||
LRR_4 | 124..161 | CDD:289563 | 10/36 (28%) | ||
LRR 5 | 125..146 | 5/20 (25%) | |||
leucine-rich repeat | 126..147 | CDD:275380 | 6/20 (30%) | ||
LRR_8 | 147..206 | CDD:290566 | 15/58 (26%) | ||
LRR 6 | 147..168 | 6/20 (30%) | |||
leucine-rich repeat | 148..171 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 171..192 | 7/20 (35%) | |||
leucine-rich repeat | 172..196 | CDD:275380 | 8/23 (35%) | ||
LRR 8 | 196..205 | 1/8 (13%) | |||
CCP110-binding | 300..750 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 506..529 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 715..769 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |