DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and Lrrc9

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:XP_006516438.1 Gene:Lrrc9 / 78257 MGIID:1925507 Length:1457 Species:Mus musculus


Alignment Length:298 Identity:69/298 - (23%)
Similarity:123/298 - (41%) Gaps:69/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MP--PPEVRLNQQNPAQQ--------QQQRMQFNRRQLGRRNSFDRDVAIAEEEQHLPAFVHLLP 94
            ||  .|:..|:.:....|        ||...:.||..:|..|                     ||
Mouse  1146 MPRLKPQTHLSSRQLLYQKVPSSGYGQQGTSKLNRDSVGSEN---------------------LP 1189

  Fly    95 VVLPQQGPEPTLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLD---LSGSVL 156
            .:                      ::::|.:.|   .|....:.:.|.|.||::|.   |.|:.:
Mouse  1190 PI----------------------MQSLEVLHL---GYNGICNLVQLQLNRLRNLKFLFLQGNEI 1229

  Fly   157 SSLRDLGYGLLQLTRLDISNCGLNSFDGT--SGLPAIRVLIADGNMIQRVDPLAELVHLRVLKAR 219
            |.:..|. .|:.|..|.:.:..:.:|:.|  |...::.:|..:.|.::.:..|..||.|..|...
Mouse  1230 SQVEGLD-NLIVLQELVVDHNRIRAFNDTAFSKPSSLLMLHLEENRLRELSKLQSLVKLEKLFLG 1293

  Fly   220 NNRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGE---PAPVE 281
            .|:|.::..|..|.:.|.|:|:.:.|||:||..::|.:|...:|.||:|||..:|.:   .|...
Mouse  1294 YNKIQDITELEKLDVIPSLRELTVYGNPICRKMVHRHVLIFRLPNLQMLDGIPINSDDRAKAEFH 1358

  Fly   282 MEEATSPASSDLESGSETT-AQRPNTAPAPEP---VPI 315
            ..|..:..||.:::...|: :..|:....|.|   ||:
Mouse  1359 FSELQAKKSSIIQNNLPTSKSSLPSHLQTPLPCKFVPV 1396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 15/61 (25%)
leucine-rich repeat 146..168 CDD:275380 7/24 (29%)
LRR_4 168..209 CDD:289563 8/42 (19%)
leucine-rich repeat 169..190 CDD:275380 5/22 (23%)
leucine-rich repeat 191..212 CDD:275380 4/20 (20%)
leucine-rich repeat 213..237 CDD:275380 6/23 (26%)
Lrrc9XP_006516438.1 internalin_A <32..>264 CDD:380193
leucine-rich repeat 47..77 CDD:275380
leucine-rich repeat 78..99 CDD:275380
leucine-rich repeat 100..121 CDD:275380
leucine-rich repeat 122..143 CDD:275380
leucine-rich repeat 144..166 CDD:275380
leucine-rich repeat 167..191 CDD:275380
leucine-rich repeat 192..223 CDD:275380
internalin_A 685..>959 CDD:380193
leucine-rich repeat 689..708 CDD:275380
leucine-rich repeat 709..730 CDD:275380
leucine-rich repeat 731..752 CDD:275380
leucine-rich repeat 753..779 CDD:275380
leucine-rich repeat 780..806 CDD:275380
leucine-rich repeat 807..865 CDD:275380
leucine-rich repeat 866..901 CDD:275380
internalin_A 879..>1262 CDD:380193 31/162 (19%)
leucine-rich repeat 902..923 CDD:275380
leucine-rich repeat 924..945 CDD:275380
leucine-rich repeat 946..969 CDD:275380
leucine-rich repeat 992..1016 CDD:275380
leucine-rich repeat 1017..1044 CDD:275380
leucine-rich repeat 1132..1157 CDD:275380 4/10 (40%)
leucine-rich repeat 1158..1194 CDD:275380 9/78 (12%)
leucine-rich repeat 1195..1218 CDD:275380 7/25 (28%)
leucine-rich repeat 1219..1240 CDD:275380 6/21 (29%)
LRR_9 <1227..1366 CDD:373143 38/139 (27%)
leucine-rich repeat 1241..1264 CDD:275380 5/22 (23%)
leucine-rich repeat 1265..1286 CDD:275380 4/20 (20%)
leucine-rich repeat 1287..1311 CDD:275380 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.