DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and drc3

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:XP_021327254.1 Gene:drc3 / 777619 ZFINID:ZDB-GENE-061103-349 Length:514 Species:Danio rerio


Alignment Length:316 Identity:75/316 - (23%)
Similarity:121/316 - (38%) Gaps:52/316 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PVVLPQQGPEPTLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLF-LPRLQSLDLSGSVLS 157
            |.|:.:|..:..::|...|.|:...||.|.::||   .|...|....|: ...|..|.|..:.:.
Zfish     9 PGVIDEQMLQRAVEEQQTRYTEGIQLEEVLELRL---DYRNILKIYHLWSFSSLTKLQLDNNAIE 70

  Fly   158 SLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNNR 222
            .:..| ..|..||.||:|...:...:|...|..::.|....|.|..::.|..|..|:||...||.
Zfish    71 RIEGL-ENLTNLTWLDLSFNKIEVIEGLQTLVKLQDLSLFNNRISVIENLDTLQRLQVLSLGNNS 134

  Fly   223 ISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGEPAPV------- 280
            |::|..:.:|.....|:.:.|.|||:|....|::.::..:|.|..||.|:|:.:....       
Zfish   135 IAQLENVIYLRRFQSLRTLNLAGNPICEEDRYKTFVSAYLPELVYLDYRLLDEQTRETANAKYQY 199

  Fly   281 --------EME-----EATSPASSDLESGSETTAQRPNTAPA--------PEPVPIALNAAIRRQ 324
                    ||:     ||...::.:|:...:...:..|.|..        |:...:||       
Zfish   200 AIEEMRQNEMQEQQAMEAQKISNEELQLHKDAFVENLNGAQLFHSMFADDPDAEKLAL------- 257

  Fly   325 VSASSGSTPVAGSVLSLVRQRRRRSGHAWVSSSSSSGSSSASSARSTRAPSMSSCS 380
                   .|...::|...|.|...     |.........|..|.||....|..|||
Zfish   258 -------LPGVDALLEEFRSRMEA-----VCMQMFEAGLSQYSRRSAEVESFFSCS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 14/56 (25%)
leucine-rich repeat 146..168 CDD:275380 5/21 (24%)
LRR_4 168..209 CDD:289563 11/40 (28%)
leucine-rich repeat 169..190 CDD:275380 7/20 (35%)
leucine-rich repeat 191..212 CDD:275380 5/20 (25%)
leucine-rich repeat 213..237 CDD:275380 8/23 (35%)
drc3XP_021327254.1 leucine-rich repeat 39..58 CDD:275380 5/21 (24%)
leucine-rich repeat 59..80 CDD:275378 5/21 (24%)
LRR_9 61..198 CDD:317038 37/137 (27%)
leucine-rich repeat 81..102 CDD:275378 7/20 (35%)
leucine-rich repeat 103..124 CDD:275378 5/20 (25%)
leucine-rich repeat 125..149 CDD:275378 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.