DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and Lrriq3

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_083214.2 Gene:Lrriq3 / 74435 MGIID:1921685 Length:633 Species:Mus musculus


Alignment Length:127 Identity:29/127 - (22%)
Similarity:48/127 - (37%) Gaps:25/127 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPL-------------------------AELVHLR 214
            |...|.|.:......::||.|...|.:..:.||                         :.|.:|:
Mouse    36 SGLHLKSMENLQTCISLRVCIFSNNFLTDIQPLQSCKKLIKLDLHGNQIKTLPDKNFWSGLKNLK 100

  Fly   215 VLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGE 276
            :|...:|..|:|..:..|..|..|..:.:...||.....||.:|..|:..|:.||..|::.|
Mouse   101 LLYLHDNGFSKLKNICVLSGCVSLIGLTMFDCPVSLKKGYRHVLVNSIWPLKALDHHVISDE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 7/25 (28%)
leucine-rich repeat 146..168 CDD:275380
LRR_4 168..209 CDD:289563 9/58 (16%)
leucine-rich repeat 169..190 CDD:275380 3/14 (21%)
leucine-rich repeat 191..212 CDD:275380 7/45 (16%)
leucine-rich repeat 213..237 CDD:275380 7/23 (30%)
Lrriq3NP_083214.2 LRR_8 51..109 CDD:338972 10/57 (18%)
LRR 1 51..72 6/20 (30%)
leucine-rich repeat 52..73 CDD:275378 6/20 (30%)
LRR 2 73..94 0/20 (0%)
leucine-rich repeat 74..98 CDD:275378 1/23 (4%)
LRR 3 98..119 5/20 (25%)
leucine-rich repeat 99..112 CDD:275378 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..343
SidE <459..630 CDD:289056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.