DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and Lrriq3

DIOPT Version :10

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_083214.2 Gene:Lrriq3 / 74435 MGIID:1921685 Length:633 Species:Mus musculus


Alignment Length:127 Identity:29/127 - (22%)
Similarity:48/127 - (37%) Gaps:25/127 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPL-------------------------AELVHLR 214
            |...|.|.:......::||.|...|.:..:.||                         :.|.:|:
Mouse    36 SGLHLKSMENLQTCISLRVCIFSNNFLTDIQPLQSCKKLIKLDLHGNQIKTLPDKNFWSGLKNLK 100

  Fly   215 VLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGE 276
            :|...:|..|:|..:..|..|..|..:.:...||.....||.:|..|:..|:.||..|::.|
Mouse   101 LLYLHDNGFSKLKNICVLSGCVSLIGLTMFDCPVSLKKGYRHVLVNSIWPLKALDHHVISDE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 leucine-rich repeat 146..168 CDD:275380
PPP1R42 <169..271 CDD:455733 27/120 (23%)
leucine-rich repeat 169..190 CDD:275380 3/14 (21%)
leucine-rich repeat 191..212 CDD:275380 7/45 (16%)
leucine-rich repeat 213..237 CDD:275380 7/23 (30%)
Lrriq3NP_083214.2 LRR <4..>124 CDD:443914 17/87 (20%)
LRR 1 51..72 6/20 (30%)
leucine-rich repeat 52..73 CDD:275378 6/20 (30%)
LRR 2 73..94 0/20 (0%)
leucine-rich repeat 74..98 CDD:275378 1/23 (4%)
LRR 3 98..119 5/20 (25%)
leucine-rich repeat 99..112 CDD:275378 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..343
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.