| Sequence 1: | NP_649175.1 | Gene: | CG14185 / 40197 | FlyBaseID: | FBgn0036936 | Length: | 402 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_083091.1 | Gene: | Cep97 / 74201 | MGIID: | 1921451 | Length: | 856 | Species: | Mus musculus |
| Alignment Length: | 357 | Identity: | 74/357 - (20%) |
|---|---|---|---|
| Similarity: | 134/357 - (37%) | Gaps: | 79/357 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 97 LPQQGPEPTLDELLRRVTQRTDLEAVEQ-----------VRLRVISYTVSLSRLSL--------- 141
Fly 142 ---FLPRLQSLDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQ- 202
Fly 203 -RVDPLAELVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNP-VCRLPL-----YRSLLAR 260
Fly 261 SVPTLQLLDGRVLNGEPAPVEMEEATSPASSDLESGSETTAQRPN---------TAPAPEPVPIA 316
Fly 317 LNAAIRRQVSASSGSTPVAGSVLSLVRQRRRRSGHAWVSSSSSSGSSSASSARSTRAPSMSSCSS 381
Fly 382 --------------NSSLDVQSSSHYVFSTQS 399 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14185 | NP_649175.1 | LRR_8 | 144..201 | CDD:290566 | 14/56 (25%) |
| leucine-rich repeat | 146..168 | CDD:275380 | 5/21 (24%) | ||
| LRR_4 | 168..209 | CDD:289563 | 12/42 (29%) | ||
| leucine-rich repeat | 169..190 | CDD:275380 | 6/20 (30%) | ||
| leucine-rich repeat | 191..212 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 213..237 | CDD:275380 | 8/23 (35%) | ||
| Cep97 | NP_083091.1 | leucine-rich repeat | 17..37 | CDD:275380 | 2/4 (50%) |
| LRR 1 | 37..58 | 4/20 (20%) | |||
| leucine-rich repeat | 38..59 | CDD:275380 | 4/20 (20%) | ||
| LRR_4 | 58..99 | CDD:289563 | 6/40 (15%) | ||
| LRR 2 | 59..80 | 3/20 (15%) | |||
| leucine-rich repeat | 60..81 | CDD:275380 | 2/20 (10%) | ||
| LRR_8 | 80..136 | CDD:290566 | 13/56 (23%) | ||
| LRR_4 | 80..122 | CDD:289563 | 9/42 (21%) | ||
| LRR 3 | 81..102 | 3/20 (15%) | |||
| leucine-rich repeat | 82..103 | CDD:275380 | 4/20 (20%) | ||
| LRR_4 | 103..144 | CDD:289563 | 9/41 (22%) | ||
| LRR 4 | 103..124 | 5/21 (24%) | |||
| leucine-rich repeat | 104..125 | CDD:275380 | 5/21 (24%) | ||
| LRR 5 | 125..146 | 5/20 (25%) | |||
| leucine-rich repeat | 126..147 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 147..206 | CDD:290566 | 15/58 (26%) | ||
| LRR 6 | 147..168 | 6/20 (30%) | |||
| leucine-rich repeat | 148..171 | CDD:275380 | 6/22 (27%) | ||
| LRR 7 | 171..192 | 7/20 (35%) | |||
| leucine-rich repeat | 172..196 | CDD:275380 | 8/23 (35%) | ||
| LRR 8 | 196..205 | 1/8 (13%) | |||
| CCP110-binding. /evidence=ECO:0000250 | 300..742 | 13/69 (19%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 430..451 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 498..525 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 646..672 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 737..840 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||