Sequence 1: | NP_649175.1 | Gene: | CG14185 / 40197 | FlyBaseID: | FBgn0036936 | Length: | 402 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157051.1 | Gene: | Lrrcc1 / 71710 | MGIID: | 1918960 | Length: | 1026 | Species: | Mus musculus |
Alignment Length: | 251 | Identity: | 64/251 - (25%) |
---|---|---|---|
Similarity: | 114/251 - (45%) | Gaps: | 55/251 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 135 SLSRLSLFLPRLQSLDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGN 199
Fly 200 MIQRVDPLAELVHLRVLKARNNRISEL-GLLSFLGMCPQLQEVEL-------------------- 243
Fly 244 ----------QGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGEPAPVEMEEATSPASSDLESGSE 298
Fly 299 TTAQRPNTAPAPEPVPIALNAAIRRQVSA----------SSGSTP---VAGSVLSL 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14185 | NP_649175.1 | LRR_8 | 144..201 | CDD:290566 | 10/56 (18%) |
leucine-rich repeat | 146..168 | CDD:275380 | 2/21 (10%) | ||
LRR_4 | 168..209 | CDD:289563 | 12/40 (30%) | ||
leucine-rich repeat | 169..190 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 191..212 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 213..237 | CDD:275380 | 8/24 (33%) | ||
Lrrcc1 | NP_001157051.1 | LRR | <30..115 | CDD:227223 | 23/86 (27%) |
LRR 1 | 39..60 | 2/21 (10%) | |||
leucine-rich repeat | 43..61 | CDD:275378 | 2/18 (11%) | ||
LRR_4 | 61..101 | CDD:289563 | 11/39 (28%) | ||
LRR 2 | 61..82 | 5/20 (25%) | |||
leucine-rich repeat | 62..83 | CDD:275378 | 6/20 (30%) | ||
LRR_8 | 82..142 | CDD:290566 | 18/59 (31%) | ||
LRR_4 | 82..122 | CDD:289563 | 13/39 (33%) | ||
LRR 3 | 83..104 | 6/20 (30%) | |||
leucine-rich repeat | 84..105 | CDD:275378 | 7/20 (35%) | ||
LRR_4 | 105..148 | CDD:289563 | 10/42 (24%) | ||
LRR 4 | 105..126 | 7/20 (35%) | |||
leucine-rich repeat | 106..131 | CDD:275378 | 8/24 (33%) | ||
LRR 5 | 131..152 | 2/20 (10%) | |||
leucine-rich repeat | 132..145 | CDD:275378 | 2/12 (17%) | ||
leucine-rich repeat | 158..188 | CDD:275380 | 7/29 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 310..338 | ||||
SbcC | <421..952 | CDD:223496 | |||
FAM184 | 793..1026 | CDD:292293 | |||
DUF342 | <817..894 | CDD:302792 | |||
RRF | <915..969 | CDD:294170 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |