Sequence 1: | NP_649175.1 | Gene: | CG14185 / 40197 | FlyBaseID: | FBgn0036936 | Length: | 402 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032463.1 | Gene: | ppp1r7 / 560323 | ZFINID: | ZDB-GENE-051113-288 | Length: | 345 | Species: | Danio rerio |
Alignment Length: | 330 | Identity: | 74/330 - (22%) |
---|---|---|---|
Similarity: | 128/330 - (38%) | Gaps: | 84/330 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 ESSPDQ----SLQAELPILLAP-----PGPAALAQVRMPPPE----------------------- 44
Fly 45 -VRLNQQNPAQQQQQRMQFNRRQLGRRNSFDRDV-------AIAEEEQHLPAFVHLLPVVLPQQG 101
Fly 102 PEPTLDEL---------------LRRVTQRTDLEAVE--QVRLRVISYTVSLSRL-SLFL----- 143
Fly 144 PRLQSLD---------LSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGN 199
Fly 200 MIQRVDPLAELVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPT 264
Fly 265 LQLLD 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14185 | NP_649175.1 | LRR_8 | 144..201 | CDD:290566 | 14/65 (22%) |
leucine-rich repeat | 146..168 | CDD:275380 | 7/30 (23%) | ||
LRR_4 | 168..209 | CDD:289563 | 8/40 (20%) | ||
leucine-rich repeat | 169..190 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 191..212 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 213..237 | CDD:275380 | 5/23 (22%) | ||
ppp1r7 | NP_001032463.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..53 | 10/30 (33%) | |
LRR 1 | 62..83 | 1/20 (5%) | |||
LRR 2 | 84..105 | 2/20 (10%) | |||
LRR_8 | 86..139 | CDD:290566 | 10/56 (18%) | ||
LRR_4 | 86..124 | CDD:289563 | 5/40 (13%) | ||
leucine-rich repeat | 86..106 | CDD:275380 | 2/19 (11%) | ||
LRR_4 | 106..147 | CDD:289563 | 12/51 (24%) | ||
LRR 3 | 106..127 | 4/23 (17%) | |||
leucine-rich repeat | 107..128 | CDD:275380 | 4/23 (17%) | ||
LRR_4 | 127..169 | CDD:289563 | 10/49 (20%) | ||
LRR 4 | 128..149 | 9/28 (32%) | |||
leucine-rich repeat | 129..150 | CDD:275380 | 9/28 (32%) | ||
LRR 5 | 150..171 | 0/20 (0%) | |||
leucine-rich repeat | 151..172 | CDD:275380 | 0/20 (0%) | ||
LRR 6 | 172..193 | 7/20 (35%) | |||
leucine-rich repeat | 173..216 | CDD:275380 | 18/42 (43%) | ||
LRR 7 | 194..215 | 9/20 (45%) | |||
LRR_8 | 216..271 | CDD:290566 | 10/55 (18%) | ||
LRR_4 | 216..257 | CDD:289563 | 8/41 (20%) | ||
LRR 8 | 216..237 | 2/21 (10%) | |||
leucine-rich repeat | 217..238 | CDD:275380 | 3/21 (14%) | ||
LRR_4 | 238..279 | CDD:289563 | 8/40 (20%) | ||
LRR 9 | 238..259 | 5/20 (25%) | |||
leucine-rich repeat | 239..260 | CDD:275380 | 5/20 (25%) | ||
LRR_4 | 259..301 | CDD:289563 | 8/41 (20%) | ||
LRR 10 | 260..281 | 3/20 (15%) | |||
leucine-rich repeat | 261..282 | CDD:275380 | 4/20 (20%) | ||
LRR 11 | 282..303 | 4/20 (20%) | |||
leucine-rich repeat | 283..307 | CDD:275380 | 5/23 (22%) | ||
LRRcap | 321..339 | CDD:197729 | 4/17 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |