DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and ppp1r7

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001032463.1 Gene:ppp1r7 / 560323 ZFINID:ZDB-GENE-051113-288 Length:345 Species:Danio rerio


Alignment Length:330 Identity:74/330 - (22%)
Similarity:128/330 - (38%) Gaps:84/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ESSPDQ----SLQAELPILLAP-----PGPAALAQVRMPPPE----------------------- 44
            ||..|:    ||..|:..|.||     ..|..:..:.:.|.|                       
Zfish    22 ESGDDETKRKSLNGEVDSLQAPSTVPEESPVDMDTITLDPEEEDVDLVHCRIGKIEGLEVLLKAK 86

  Fly    45 -VRLNQQNPAQQQQQRMQFNRRQLGRRNSFDRDV-------AIAEEEQHLPAFVHLLPVVLPQQG 101
             :.|.|....:.:......:.|:|   :.:|..:       |:.|.|| |....:||..:   :|
Zfish    87 TISLRQNLIKRIENLESLVSLREL---DLYDNQIRKLENLQALTELEQ-LDVSFNLLRKI---EG 144

  Fly   102 PEPTLDEL---------------LRRVTQRTDLEAVE--QVRLRVISYTVSLSRL-SLFL----- 143
                ||.|               :..:...|.|:.:|  ..|:|||....|||.| ||||     
Zfish   145 ----LDSLTKVKKLFLLHNKIASIANLDHLTSLQMLELGSNRIRVIENLDSLSSLESLFLGTNKI 205

  Fly   144 PRLQSLD---------LSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGN 199
            .:||:||         :..:.::.|..| ..|:.|..|.:|:.|:...:|......:..|....|
Zfish   206 TQLQNLDGLHNLTVLSIQSNRITKLEGL-QNLVNLRELYLSHNGIEVMEGLENNKKLSTLDIAAN 269

  Fly   200 MIQRVDPLAELVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPT 264
            .|::::.::.|..|:.....:|:|.....|..|.....|:.|.|:.||:.:.|.||..:..::|:
Zfish   270 RIKKIENISHLTDLKEFWMNDNQIENWADLDELKNAKGLETVYLERNPLQKDPQYRRKIMLALPS 334

  Fly   265 LQLLD 269
            ::.:|
Zfish   335 VRQID 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 14/65 (22%)
leucine-rich repeat 146..168 CDD:275380 7/30 (23%)
LRR_4 168..209 CDD:289563 8/40 (20%)
leucine-rich repeat 169..190 CDD:275380 5/20 (25%)
leucine-rich repeat 191..212 CDD:275380 4/20 (20%)
leucine-rich repeat 213..237 CDD:275380 5/23 (22%)
ppp1r7NP_001032463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 10/30 (33%)
LRR 1 62..83 1/20 (5%)
LRR 2 84..105 2/20 (10%)
LRR_8 86..139 CDD:290566 10/56 (18%)
LRR_4 86..124 CDD:289563 5/40 (13%)
leucine-rich repeat 86..106 CDD:275380 2/19 (11%)
LRR_4 106..147 CDD:289563 12/51 (24%)
LRR 3 106..127 4/23 (17%)
leucine-rich repeat 107..128 CDD:275380 4/23 (17%)
LRR_4 127..169 CDD:289563 10/49 (20%)
LRR 4 128..149 9/28 (32%)
leucine-rich repeat 129..150 CDD:275380 9/28 (32%)
LRR 5 150..171 0/20 (0%)
leucine-rich repeat 151..172 CDD:275380 0/20 (0%)
LRR 6 172..193 7/20 (35%)
leucine-rich repeat 173..216 CDD:275380 18/42 (43%)
LRR 7 194..215 9/20 (45%)
LRR_8 216..271 CDD:290566 10/55 (18%)
LRR_4 216..257 CDD:289563 8/41 (20%)
LRR 8 216..237 2/21 (10%)
leucine-rich repeat 217..238 CDD:275380 3/21 (14%)
LRR_4 238..279 CDD:289563 8/40 (20%)
LRR 9 238..259 5/20 (25%)
leucine-rich repeat 239..260 CDD:275380 5/20 (25%)
LRR_4 259..301 CDD:289563 8/41 (20%)
LRR 10 260..281 3/20 (15%)
leucine-rich repeat 261..282 CDD:275380 4/20 (20%)
LRR 11 282..303 4/20 (20%)
leucine-rich repeat 283..307 CDD:275380 5/23 (22%)
LRRcap 321..339 CDD:197729 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.