DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and lrguk

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:XP_021330922.1 Gene:lrguk / 559670 ZFINID:ZDB-GENE-050419-232 Length:739 Species:Danio rerio


Alignment Length:207 Identity:53/207 - (25%)
Similarity:88/207 - (42%) Gaps:50/207 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DLEAVEQVRLRVISYTVSLSRLSLFL----PR-LQSLDLSGSVLSSLRDL-GYGLL--------- 167
            ||..|..:.. :|:...|.::|:.|.    |: |:.::.|.:.:::::|| .|..|         
Zfish    73 DLSCVSHMPY-LITLDASHNQLTDFFGFQPPKNLKEVNFSHNQMTAMKDLSAYSSLTKLILDHNS 136

  Fly   168 -----------QLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNN 221
                       :|:.|.:::..::...|...|| :|.|...||||.:::.|..|.:|:||....|
Zfish   137 FSVIRGLEKCKRLSHLSLAHNNISRIRGLDHLP-LRELCLAGNMINKIENLQTLHNLQVLDLSCN 200

  Fly   222 RISEL-GL--LSFLGMCP-------------------QLQEVELQGNPVCRLPLYRSLLARSVPT 264
            ||..| ||  |.|||...                   .|:|:.|..|||.....||..:...:..
Zfish   201 RIQSLTGLQNLRFLGTVNLESNLITEIKEAAHLHDLILLREINLLKNPVQDHDDYRIAVIFLLQH 265

  Fly   265 LQLLDGRVLNGE 276
            |.|||.:.:..|
Zfish   266 LILLDKQTVTAE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 16/78 (21%)
leucine-rich repeat 146..168 CDD:275380 6/42 (14%)
LRR_4 168..209 CDD:289563 12/40 (30%)
leucine-rich repeat 169..190 CDD:275380 4/20 (20%)
leucine-rich repeat 191..212 CDD:275380 8/20 (40%)
leucine-rich repeat 213..237 CDD:275380 13/45 (29%)
lrgukXP_021330922.1 LRR <25..>247 CDD:227223 43/175 (25%)
leucine-rich repeat 61..82 CDD:275380 3/8 (38%)
leucine-rich repeat 83..104 CDD:275380 5/20 (25%)
leucine-rich repeat 105..126 CDD:275380 5/20 (25%)
leucine-rich repeat 127..148 CDD:275380 1/20 (5%)
leucine-rich repeat 149..168 CDD:275380 3/18 (17%)
leucine-rich repeat 170..191 CDD:275380 8/20 (40%)
leucine-rich repeat 192..210 CDD:275380 9/17 (53%)
leucine-rich repeat 211..238 CDD:275380 4/26 (15%)
GMPK 326..449 CDD:238026
Herpes_ICP4_C 520..>739 CDD:332854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.