DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and dnal1

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:XP_012823845.1 Gene:dnal1 / 549066 XenbaseID:XB-GENE-983792 Length:201 Species:Xenopus tropicalis


Alignment Length:212 Identity:52/212 - (24%)
Similarity:91/212 - (42%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QQGPEPTLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRL---QSLDLSGSVLSSLR 160
            :|....|:.|.|.:..:||..:|.|...:::.:....:.::...|..|   :.|.||.:.:..:.
 Frog     9 EQAKATTIKEALAKWEERTGQKAGEAKEVKLYAQIPPIEKMDASLSTLVNCEKLSLSTNCIEKIA 73

  Fly   161 DLGYGLLQLTRLDISNCGLNSFDGTSGLPAI----RVLIADGNMIQRVDPLAELVHLRVLKARNN 221
            :|.    .|..|.|.:.|.|:....:||.|:    ..|....|:|:::..:..:..|:||...||
 Frog    74 NLN----GLKFLRILSLGRNNIKNLNGLEAVGETLEELWISYNLIEKLKGIHVMKKLKVLYMSNN 134

  Fly   222 RISELGLLSFLGMCPQLQEVELQGNPV-CRLPLYRSLLARSV---PTLQLLDGRVLNGEPAPVEM 282
            .:.:....|.||..|.|:::...|||: .|.....:.|..:|   |.|:.|||.       ||..
 Frog   135 LVKDWAEFSKLGELPLLEDMVFVGNPLEERHTAEGNWLEEAVKRLPKLKKLDGN-------PVIK 192

  Fly   283 EEATSPASSDLESGSET 299
            :|.        |.|.|:
 Frog   193 QEE--------EEGDES 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 15/63 (24%)
leucine-rich repeat 146..168 CDD:275380 5/24 (21%)
LRR_4 168..209 CDD:289563 11/44 (25%)
leucine-rich repeat 169..190 CDD:275380 7/20 (35%)
leucine-rich repeat 191..212 CDD:275380 3/24 (13%)
leucine-rich repeat 213..237 CDD:275380 8/23 (35%)
dnal1XP_012823845.1 internalin_A 53..>163 CDD:380193 30/113 (27%)
leucine-rich repeat 59..80 CDD:275378 5/24 (21%)
leucine-rich repeat 81..99 CDD:275378 6/17 (35%)
leucine-rich repeat 104..125 CDD:275382 3/20 (15%)
leucine-rich repeat 126..149 CDD:275382 8/22 (36%)
leucine-rich repeat 151..181 CDD:275382 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.