DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and Lrrc6

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_062330.1 Gene:Lrrc6 / 54562 MGIID:1859553 Length:473 Species:Mus musculus


Alignment Length:184 Identity:48/184 - (26%)
Similarity:72/184 - (39%) Gaps:28/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 DELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLF---LPRLQSLDLSGSVLSSLRDLGYGLLQ 168
            ::|:||..:..|.         ||   .||..|||.   :.||:.:|      ...|||....||
Mouse     6 EDLIRRNAEHNDC---------VI---FSLEELSLHQQEIERLEHID------KWCRDLKILYLQ 52

  Fly   169 LTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNNRISELGLLSFLG 233
                   |..:...:..|.|..:..|....|.|:|::.|.....|..|....|.|.||..:..|.
Mouse    53 -------NNLIGKIENVSKLKKLEYLNLALNNIERIENLEGCEWLTKLDLTVNFIGELSSVKTLT 110

  Fly   234 MCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGEPAPVEMEEATS 287
            ....|:|:.|.|||......||..:..::..|:.|||:.:........::..||
Mouse   111 HNIHLKELFLMGNPCADFDGYRQFVVVTLQQLKWLDGKEIERSERIQALQNYTS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 13/56 (23%)
leucine-rich repeat 146..168 CDD:275380 5/21 (24%)
LRR_4 168..209 CDD:289563 9/40 (23%)
leucine-rich repeat 169..190 CDD:275380 3/20 (15%)
leucine-rich repeat 191..212 CDD:275380 5/20 (25%)
leucine-rich repeat 213..237 CDD:275380 7/23 (30%)
Lrrc6NP_062330.1 LRR_4 22..64 CDD:289563 14/54 (26%)
LRR 1 22..43 8/26 (31%)
leucine-rich repeat 23..45 CDD:275378 7/27 (26%)
LRR 2 45..66 6/27 (22%)
LRR_8 46..98 CDD:290566 13/58 (22%)
LRR_4 46..86 CDD:289563 11/46 (24%)
leucine-rich repeat 46..67 CDD:275378 6/27 (22%)
LRR 3 67..88 5/20 (25%)
leucine-rich repeat 68..89 CDD:275378 5/20 (25%)
LRR 4 89..110 6/20 (30%)
leucine-rich repeat 90..114 CDD:275378 7/23 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..244
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..292
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.