DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and sds22

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster


Alignment Length:250 Identity:47/250 - (18%)
Similarity:86/250 - (34%) Gaps:93/250 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLF--LPRLQSLDLSGSVLSSLRDLGY------- 164
            |::::...:.|:.:.::.|    |...::::...  ||.|:.||:|.:.|:.:.:|..       
  Fly    72 LIKKIENLSSLKTLIELEL----YDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKV 132

  Fly   165 --------------GLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRV 215
                          .|..||.|::.:..|...:....|..:|.|....|.|.:::.|..||:|.:
  Fly   133 YFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEI 197

  Fly   216 LKARNNRI-----------------SELGL----------------------------------- 228
            |..:.|||                 ||.|:                                   
  Fly   198 LSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLE 262

  Fly   229 --------------LSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLD 269
                          :..|.:...||.:.|:.||:.:...|||.|...:|.||.:|
  Fly   263 ELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 16/77 (21%)
leucine-rich repeat 146..168 CDD:275380 7/42 (17%)
LRR_4 168..209 CDD:289563 10/40 (25%)
leucine-rich repeat 169..190 CDD:275380 5/20 (25%)
leucine-rich repeat 191..212 CDD:275380 6/20 (30%)
leucine-rich repeat 213..237 CDD:275380 9/89 (10%)
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
LRR_8 61..117 CDD:290566 10/48 (21%)
leucine-rich repeat 63..84 CDD:275380 2/11 (18%)
LRR_4 83..125 CDD:289563 10/45 (22%)
leucine-rich repeat 85..106 CDD:275380 3/24 (13%)
LRR_8 105..183 CDD:290566 16/77 (21%)
leucine-rich repeat 107..128 CDD:275380 6/20 (30%)
LRR_4 128..168 CDD:289563 5/39 (13%)
leucine-rich repeat 129..150 CDD:275380 1/20 (5%)
LRR_4 149..189 CDD:289563 9/39 (23%)
leucine-rich repeat 151..172 CDD:275380 5/20 (25%)
leucine-rich repeat 173..194 CDD:275380 6/20 (30%)
LRR_8 194..249 CDD:290566 8/54 (15%)
LRR_4 194..235 CDD:289563 8/40 (20%)
leucine-rich repeat 195..216 CDD:275380 5/20 (25%)
leucine-rich repeat 217..238 CDD:275380 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.