DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and sds22

DIOPT Version :10

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster


Alignment Length:250 Identity:47/250 - (18%)
Similarity:86/250 - (34%) Gaps:93/250 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLF--LPRLQSLDLSGSVLSSLRDLGY------- 164
            |::::...:.|:.:.::.|    |...::::...  ||.|:.||:|.:.|:.:.:|..       
  Fly    72 LIKKIENLSSLKTLIELEL----YDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKV 132

  Fly   165 --------------GLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRV 215
                          .|..||.|::.:..|...:....|..:|.|....|.|.:::.|..||:|.:
  Fly   133 YFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEI 197

  Fly   216 LKARNNRI-----------------SELGL----------------------------------- 228
            |..:.|||                 ||.|:                                   
  Fly   198 LSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLE 262

  Fly   229 --------------LSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLD 269
                          :..|.:...||.:.|:.||:.:...|||.|...:|.||.:|
  Fly   263 ELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 leucine-rich repeat 146..168 CDD:275380 7/42 (17%)
PPP1R42 <169..271 CDD:455733 33/166 (20%)
leucine-rich repeat 169..190 CDD:275380 5/20 (25%)
leucine-rich repeat 191..212 CDD:275380 6/20 (30%)
leucine-rich repeat 213..237 CDD:275380 9/89 (10%)
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
PPP1R42 44..208 CDD:455733 30/139 (22%)
leucine-rich repeat 63..84 CDD:275380 2/11 (18%)
leucine-rich repeat 85..106 CDD:275380 3/24 (13%)
leucine-rich repeat 107..128 CDD:275380 6/20 (30%)
leucine-rich repeat 129..150 CDD:275380 1/20 (5%)
PPP1R42 132..317 CDD:455733 34/184 (18%)
leucine-rich repeat 151..172 CDD:275380 5/20 (25%)
leucine-rich repeat 173..194 CDD:275380 6/20 (30%)
leucine-rich repeat 195..216 CDD:275380 5/20 (25%)
leucine-rich repeat 217..238 CDD:275380 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.