DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and CG10839

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster


Alignment Length:132 Identity:33/132 - (25%)
Similarity:57/132 - (43%) Gaps:5/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LPRLQSLDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGL-PAIRVLIADGNMIQRVDP 206
            |...|.|.||.:::..:..:. |:..|..|.::...|.:.:|...| ..:..|....|.|::..|
  Fly    47 LTECQKLSLSSNMIEKITGIS-GMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKP 110

  Fly   207 LAELVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPV---CRLPLYRSLLARSVPTLQLL 268
            |..:..|||.....|.|.:......:|:.|.|.|:...|||:   .....:.:...|.:|.::.|
  Fly   111 LESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKL 175

  Fly   269 DG 270
            ||
  Fly   176 DG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 12/57 (21%)
leucine-rich repeat 146..168 CDD:275380 5/21 (24%)
LRR_4 168..209 CDD:289563 10/41 (24%)
leucine-rich repeat 169..190 CDD:275380 5/21 (24%)
leucine-rich repeat 191..212 CDD:275380 5/20 (25%)
leucine-rich repeat 213..237 CDD:275380 6/23 (26%)
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 21/82 (26%)
LRR_4 48..90 CDD:289563 9/42 (21%)
leucine-rich repeat 50..71 CDD:275380 5/21 (24%)
LRR_8 51..105 CDD:290566 12/54 (22%)
leucine-rich repeat 72..94 CDD:275380 5/21 (24%)
leucine-rich repeat 95..116 CDD:275380 5/20 (25%)
leucine-rich repeat 117..141 CDD:275380 6/23 (26%)
leucine-rich repeat 142..171 CDD:275380 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.