| Sequence 1: | NP_649175.1 | Gene: | CG14185 / 40197 | FlyBaseID: | FBgn0036936 | Length: | 402 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_608811.2 | Gene: | Cep97 / 33610 | FlyBaseID: | FBgn0031575 | Length: | 806 | Species: | Drosophila melanogaster |
| Alignment Length: | 364 | Identity: | 82/364 - (22%) |
|---|---|---|---|
| Similarity: | 139/364 - (38%) | Gaps: | 100/364 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 110 LRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLDLSGSVLSSLRDLGYGLLQ---LTR 171
Fly 172 LDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNNRISELGLLSFLGMCP 236
Fly 237 QLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRV--LNGEPAPVEMEEATSPASSDLESGSET 299
Fly 300 TAQRP-----NTAPAPEPVPIALNAAIR--------------------------RQVSAS----- 328
Fly 329 ----SGSTPVAGS------------VLSLVRQRRRRSGHAWVSSSSSSGSSSASSAR-------- 369
Fly 370 -------STRAPSMSSC-------SSNSSL--DVQSSSH 392 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14185 | NP_649175.1 | LRR_8 | 144..201 | CDD:290566 | 16/59 (27%) |
| leucine-rich repeat | 146..168 | CDD:275380 | 5/21 (24%) | ||
| LRR_4 | 168..209 | CDD:289563 | 13/43 (30%) | ||
| leucine-rich repeat | 169..190 | CDD:275380 | 6/20 (30%) | ||
| leucine-rich repeat | 191..212 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 213..237 | CDD:275380 | 6/23 (26%) | ||
| Cep97 | NP_608811.2 | leucine-rich repeat | 11..31 | CDD:275380 | 3/10 (30%) |
| leucine-rich repeat | 32..53 | CDD:275380 | 3/22 (14%) | ||
| LRR_RI | <49..189 | CDD:238064 | 41/155 (26%) | ||
| LRR_4 | 76..115 | CDD:289563 | 12/38 (32%) | ||
| leucine-rich repeat | 76..97 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 97..152 | CDD:290566 | 19/57 (33%) | ||
| LRR_4 | 97..137 | CDD:289563 | 12/39 (31%) | ||
| leucine-rich repeat | 98..119 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 120..141 | CDD:275380 | 6/23 (26%) | ||
| LRR_8 | 140..200 | CDD:290566 | 20/69 (29%) | ||
| leucine-rich repeat | 142..165 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 166..190 | CDD:275380 | 7/31 (23%) | ||
| IQ | 581..599 | CDD:197470 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||