DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and Lrrc23

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001381276.1 Gene:Lrrc23 / 312707 RGDID:1304779 Length:345 Species:Rattus norvegicus


Alignment Length:249 Identity:63/249 - (25%)
Similarity:102/249 - (40%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DRDVAIAEEEQHLPAFVHLLPVVLPQ-----QGPEPTLDELLRRVTQRTDLEAVEQVRLRVISY- 132
            |||:.   :...|.:::||..|.:.:     ..|   |:.|...:..:.|...:...||..:.| 
  Rat    80 DRDLT---DISLLRSYIHLRYVDISENHITDMSP---LNSLTHLLWLKADGNQLRSARLNELPYL 138

  Fly   133 ---TVSLSRLS----LFLPRLQSLDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSG--L 188
               :.|.::::    :..|||.||||.|:.:..:  .|....:||.|.......|..:.|.|  |
  Rat   139 QIASFSYNQITDTEGIIHPRLGSLDLKGNRIHQV--TGLDPERLTNLHTLELRANQLETTIGINL 201

  Fly   189 PAIRVLIADGNMIQRVDPLAEL-----VHLR------------------VLKARNNRISELGLLS 230
            |.::.|....|::::|:.|..|     :|||                  .|..|:|.||:||.|:
  Rat   202 PKLKNLYLAQNLLKKVEGLENLSNLTTLHLRDNQIETLDGFSKEMKSLQYLNLRSNMISDLGELA 266

  Fly   231 FLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGEPAPVEMEE 284
            .|...|:|:.:.|..||......||......:..|:.||......|.. .|.||
  Rat   267 KLRDLPKLRALVLLDNPCADETDYRQEALVQMAHLERLDKEYYEDEDR-AEAEE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 19/58 (33%)
leucine-rich repeat 146..168 CDD:275380 7/21 (33%)
LRR_4 168..209 CDD:289563 12/42 (29%)
leucine-rich repeat 169..190 CDD:275380 7/22 (32%)
leucine-rich repeat 191..212 CDD:275380 5/25 (20%)
leucine-rich repeat 213..237 CDD:275380 11/41 (27%)
Lrrc23NP_001381276.1 leucine-rich repeat 75..94 CDD:275380 4/16 (25%)
PPP1R42 80..306 CDD:411060 58/233 (25%)
leucine-rich repeat 95..116 CDD:275380 5/23 (22%)
leucine-rich repeat 117..137 CDD:275380 3/19 (16%)
leucine-rich repeat 138..158 CDD:275380 1/19 (5%)
leucine-rich repeat 159..182 CDD:275380 8/24 (33%)
leucine-rich repeat 183..203 CDD:275380 5/19 (26%)
leucine-rich repeat 204..225 CDD:275380 5/20 (25%)
leucine-rich repeat 226..248 CDD:275380 3/21 (14%)
leucine-rich repeat 249..273 CDD:275380 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.