DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and Drc3

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001013879.1 Gene:Drc3 / 287371 RGDID:1309150 Length:523 Species:Rattus norvegicus


Alignment Length:188 Identity:49/188 - (26%)
Similarity:86/188 - (45%) Gaps:21/188 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LLPVVLPQQGPEPTLDELLRR--------VTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQS 148
            :|.|.:.:|||:....:|.::        :..:.|.:.:    ||:       ..|..| ..|:.
  Rat    17 MLKVAVGEQGPQEEAGQLAKQEGILFKDVLALQLDFQNI----LRI-------DNLWQF-ENLRK 69

  Fly   149 LDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHL 213
            |.|:.:::..:..| ..|..|..||:|...:.:.:|...|..:..|....|.|.::|.|..||:|
  Rat    70 LQLNNNIIERIEGL-ENLTHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSHNRISKIDSLDPLVNL 133

  Fly   214 RVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGR 271
            :||...||:|:.:..:.:|...|.|:.:.|.||||.....|:..:...:|.|..||.|
  Rat   134 QVLSLGNNQINNMMNIIYLRRFPCLRTLSLSGNPVSEAEEYKVFIYAYLPDLVYLDFR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 13/56 (23%)
leucine-rich repeat 146..168 CDD:275380 5/21 (24%)
LRR_4 168..209 CDD:289563 11/40 (28%)
leucine-rich repeat 169..190 CDD:275380 6/20 (30%)
leucine-rich repeat 191..212 CDD:275380 6/20 (30%)
leucine-rich repeat 213..237 CDD:275380 7/23 (30%)
Drc3NP_001013879.1 LRR 1 44..65 5/32 (16%)
leucine-rich repeat 48..66 CDD:275378 5/29 (17%)
LRR_4 65..105 CDD:289563 9/40 (23%)
LRR_8 66..121 CDD:290566 13/55 (24%)
LRR 2 66..87 4/21 (19%)
leucine-rich repeat 67..88 CDD:275378 5/21 (24%)
LRR_4 87..129 CDD:289563 11/41 (27%)
LRR 3 88..109 5/20 (25%)
leucine-rich repeat 89..110 CDD:275378 6/20 (30%)
LRR 4 110..131 5/20 (25%)
leucine-rich repeat 111..132 CDD:275378 6/20 (30%)
LRR 5 132..153 6/20 (30%)
leucine-rich repeat 158..169 CDD:275378 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.