DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and T05H4.3

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001343670.1 Gene:T05H4.3 / 188149 WormBaseID:WBGene00020266 Length:1150 Species:Caenorhabditis elegans


Alignment Length:372 Identity:74/372 - (19%)
Similarity:142/372 - (38%) Gaps:109/372 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SFDRDVAIAEEEQHLPAF--------VHLLPVVLPQQGPEPTL---DELLRR-VTQRTDLEAVEQ 124
            |.||.: |..||:|:...        :.|:..:.|:...:..|   |:.:.: :.:::.:|.:.|
 Worm   791 SLDRQI-IPLEERHVNTMKQTTRGLSLELIERICPEWKNKKELMICDQKIEQIILEKSQMEELSQ 854

  Fly   125 VRLRVISYT--VSLSRLSLF--------------------------LPRLQSLDLSGSVLSSLRD 161
            :||..:|..  .|:..:|.|                          .|.|::||:|.:.:|:...
 Worm   855 IRLIDLSKNRLSSVREISSFNITHLILNNNCLKSIAVNDGQTSLQPFPYLENLDISNNSISNTSI 919

  Fly   162 LGYG---LLQLTRLDISNCGLNSFD-GTSGLPAIRVLIADGNMIQRV--DPLAELVHLRV----- 215
            |..|   ||:|..:::|...|:.|| ....||.:..:....|.|:.:  .||..|..|.:     
 Worm   920 LRLGIPLLLKLKNINLSQNALSRFDCSLFDLPNLESVDLSNNSIKTIIRRPLKTLTSLNLQNNKL 984

  Fly   216 -------------LKARNNRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQL 267
                         |...||:::....|..|..|..|:.::.:.|.|....:|...:...||:::.
 Worm   985 TTLTPLSCPNLVSLDISNNKLASCASLKPLCECKTLENLDCRNNSVTERRVYVDFIKAQVPSVRK 1049

  Fly   268 LDGRVLNGEPAPVEMEEATSPASSDLESGSETTAQ---------------------------RPN 305
            ||..:::.|   :|:.:.....::||.|.|..::.                           .|:
 Worm  1050 LDDEIMSNE---IEITKRRLSRANDLISMSRRSSMVTSSMLSWFEREEGETLENVKRASSFLEPS 1111

  Fly   306 TAPAP------EPVPIALNAAIRRQVSASSGSTPVAGSVLSLVRQRR 346
            .|..|      ||:|      .||:.::.|....:.|:  ..|:.|:
 Worm  1112 AAETPMRPRRLEPLP------GRRKTNSESNGLMLLGT--KAVQHRK 1150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 18/60 (30%)
leucine-rich repeat 146..168 CDD:275380 8/24 (33%)
LRR_4 168..209 CDD:289563 11/43 (26%)
leucine-rich repeat 169..190 CDD:275380 6/21 (29%)
leucine-rich repeat 191..212 CDD:275380 5/22 (23%)
leucine-rich repeat 213..237 CDD:275380 7/41 (17%)
T05H4.3NP_001343670.1 leucine-rich repeat 69..91 CDD:275380
leucine-rich repeat 92..113 CDD:275380
leucine-rich repeat 114..135 CDD:275380
leucine-rich repeat 136..157 CDD:275380
leucine-rich repeat 158..181 CDD:275380
leucine-rich repeat 182..206 CDD:275380
leucine-rich repeat 629..650 CDD:275380
PLN00113 645..>1005 CDD:331614 45/214 (21%)
leucine-rich repeat 651..672 CDD:275380
leucine-rich repeat 673..692 CDD:275380
leucine-rich repeat 693..714 CDD:275380
leucine-rich repeat 715..761 CDD:275380
leucine-rich repeat 762..815 CDD:275380 7/24 (29%)
leucine-rich repeat 816..851 CDD:275380 4/34 (12%)
leucine-rich repeat 855..875 CDD:275380 5/19 (26%)
leucine-rich repeat 876..903 CDD:275380 0/26 (0%)
leucine-rich repeat 904..952 CDD:275380 15/47 (32%)
leucine-rich repeat 953..973 CDD:275380 4/19 (21%)
leucine-rich repeat 974..994 CDD:275380 2/19 (11%)
leucine-rich repeat 995..1019 CDD:275380 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.