DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and C06A8.6

DIOPT Version :10

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_495634.1 Gene:C06A8.6 / 174253 WormBaseID:WBGene00015516 Length:349 Species:Caenorhabditis elegans


Alignment Length:171 Identity:38/171 - (22%)
Similarity:73/171 - (42%) Gaps:18/171 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TDLEAVEQ-----VRLRVISYTVSLSRLSL------------FLPRLQSLDLSGSVLSSLRDLGY 164
            |:||.:|.     .::..:...:.|.||.|            .|.:|..|.|..:.::.:.::. 
 Worm   142 TELEYLELGDNRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLTVLSLPANAITVVDNIS- 205

  Fly   165 GLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNNRISELGLL 229
            ||..|..:.::..|:....|......:.:|..:.|.:::|:.:.:|..|....||.|::....::
 Worm   206 GLHNLKEIYLAQNGIKYVCGIDEHLPLEILDFNQNRLEKVENIHQLKTLTDFWARGNKLDNWSIM 270

  Fly   230 SFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDG 270
            ..|...|||..|.|..||:..:..||..:...:..:..|||
 Worm   271 DELVELPQLNSVYLDFNPIASVDTYRGKVIHLLQQITRLDG 311

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 leucine-rich repeat 146..168 CDD:275380 5/21 (24%)
PPP1R42 <169..271 CDD:455733 24/102 (24%)
leucine-rich repeat 169..190 CDD:275380 3/20 (15%)
leucine-rich repeat 191..212 CDD:275380 4/20 (20%)
leucine-rich repeat 213..237 CDD:275380 5/23 (22%)
C06A8.6NP_495634.1 leucine-rich repeat 35..55 CDD:275380
leucine-rich repeat 56..77 CDD:275380
PPP1R42 66..218 CDD:455733 15/76 (20%)
leucine-rich repeat 78..99 CDD:275380
leucine-rich repeat 100..121 CDD:275380