Sequence 1: | NP_649175.1 | Gene: | CG14185 / 40197 | FlyBaseID: | FBgn0036936 | Length: | 402 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254924.1 | Gene: | K10D2.8 / 13189483 | WormBaseID: | WBGene00189952 | Length: | 335 | Species: | Caenorhabditis elegans |
Alignment Length: | 277 | Identity: | 59/277 - (21%) |
---|---|---|---|
Similarity: | 110/277 - (39%) | Gaps: | 85/277 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 LGRRNSFDRDVAIAEEEQHLPAFVHLLPVVLPQQGPEPTLDELLRRVT------QRTDLEAVEQV 125
Fly 126 RLRVI---------------------------SYTVSLSRLSL------------FLPRLQSLDL 151
Fly 152 SGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVL 216
Fly 217 KARNNRISELGLLSFLGMC----PQLQEVE------LQGNPVCRLP-LYRSLLARSVPTLQLLDG 270
Fly 271 RVL---NGEP-APVEME 283 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14185 | NP_649175.1 | LRR_8 | 144..201 | CDD:290566 | 16/56 (29%) |
leucine-rich repeat | 146..168 | CDD:275380 | 7/21 (33%) | ||
LRR_4 | 168..209 | CDD:289563 | 10/40 (25%) | ||
leucine-rich repeat | 169..190 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 191..212 | CDD:275380 | 3/20 (15%) | ||
leucine-rich repeat | 213..237 | CDD:275380 | 4/27 (15%) | ||
K10D2.8 | NP_001254924.1 | leucine-rich repeat | 30..50 | CDD:275380 | |
LRR_4 | 49..90 | CDD:289563 | 5/19 (26%) | ||
leucine-rich repeat | 51..72 | CDD:275380 | |||
LRR_8 | 71..127 | CDD:290566 | 15/67 (22%) | ||
LRR_4 | 71..113 | CDD:289563 | 12/53 (23%) | ||
leucine-rich repeat | 73..94 | CDD:275380 | 6/23 (26%) | ||
LRR_4 | 94..134 | CDD:289563 | 9/50 (18%) | ||
leucine-rich repeat | 95..116 | CDD:275380 | 5/31 (16%) | ||
LRR_4 | 116..157 | CDD:289563 | 4/40 (10%) | ||
leucine-rich repeat | 117..138 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 139..160 | CDD:275380 | 1/20 (5%) | ||
LRR_4 | 160..199 | CDD:289563 | 9/38 (24%) | ||
leucine-rich repeat | 161..182 | CDD:275380 | 4/20 (20%) | ||
LRR_8 | 182..235 | CDD:290566 | 15/53 (28%) | ||
leucine-rich repeat | 183..204 | CDD:275380 | 7/21 (33%) | ||
LRR_4 | 205..245 | CDD:289563 | 10/39 (26%) | ||
leucine-rich repeat | 205..226 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 252..273 | CDD:275380 | 6/30 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |