DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14185 and LRRIQ3

DIOPT Version :9

Sequence 1:	NP_649175.1	Gene:	CG14185 / 40197	FlyBaseID:	FBgn0036936	Length:	402	Species:	Drosophila melanogaster
Sequence 2:	NP_001099129.1	Gene:	LRRIQ3 / 127255	HGNCID:	28318	Length:	624	Species:	Homo sapiens

Alignment Length:	123	Identity:	31/123 - (25%)
Similarity:	45/123 - (36%)	Gaps:	25/123 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   179 LNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNNRISEL-------GL-------- 228
            |.|.:......::||.|...|.|..:.||...:.|..|....|:|..|       ||
Human    40 LKSMENLQSCISLRVCIFSNNFITDIHPLQSCIKLIKLDLHGNQIKSLPNTKFWNGLKNLKLLYL 104

  Fly   229 ----------LSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGE 276
                      :..|..||.|..:.:...||.....||.:|..|:..|:.||..|::.|
Human   105 HDNGFAKLKNICVLSACPTLIALTMFDCPVSLKKGYRHVLVNSIWPLKALDHHVISDE 162

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14185	NP_649175.1	LRR_8	144..201	CDD:290566	6/21 (29%)
		leucine-rich repeat	146..168	CDD:275380
		LRR_4	168..209	CDD:289563	9/29 (31%)
		leucine-rich repeat	169..190	CDD:275380	2/10 (20%)
		leucine-rich repeat	191..212	CDD:275380	7/20 (35%)
		leucine-rich repeat	213..237	CDD:275380	9/48 (19%)
LRRIQ3	NP_001099129.1	LRR_8	51..109	CDD:290566	14/57 (25%)
		LRR_4	51..89	CDD:289563	12/37 (32%)
		LRR 1	51..72		7/20 (35%)
		leucine-rich repeat	52..73	CDD:275378	7/20 (35%)
		LRR_4	73..115	CDD:289563	7/41 (17%)
		LRR 2	73..94		5/20 (25%)
		leucine-rich repeat	74..98	CDD:275378	7/23 (30%)
		LRR 3	98..119		0/20 (0%)
		leucine-rich repeat	99..123	CDD:275378	2/23 (9%)
		leucine-rich repeat	124..135	CDD:275378	2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900