DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and U2A

DIOPT Version :10

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:XP_308200.4 Gene:U2A / 1269557 VectorBaseID:AGAMI1_005548 Length:248 Species:Anopheles gambiae


Alignment Length:221 Identity:59/221 - (26%)
Similarity:93/221 - (42%) Gaps:26/221 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 RLQSLDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRV-DPLA 208
            |.:.|||.|..:..:.::|..|.|...:|.|:..:...||...|..::.|:.:.|.|.|: :.|.
Mosquito    20 RDRELDLRGYKIPQIENMGATLDQYDTIDFSDNDIRKLDGFPRLARLKCLLLNNNRIVRIGENLH 84

  Fly   209 E-LVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRV 272
            | |.:|:.:....|.|.|||.|..|...|.|:.:.|..|||.....||..:|...|.|:|||.|.
Mosquito    85 ESLPNLQSIILTGNNIQELGDLEPLTKLPNLETLSLLTNPVSTKQHYREYVAFRFPNLRLLDFRK 149

  Fly   273 LNGEPAP------------------VEMEEATSPASSDLESGSETTAQRPNTAPA-----PEPVP 314
            :..:...                  |...:...||.:..||..|..|.: |.:||     .|.:.
Mosquito   150 IRQKEREAANLLFKSKKGKEMHKEIVRKAKRALPAGALGESSPEKQAVQ-NASPADIQKIKEAIK 213

  Fly   315 IALNAAIRRQVSASSGSTPVAGSVLS 340
            .|.|.....:::....|..:.|.:|:
Mosquito   214 RATNLHEVERLNRMLQSGQITGDILN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 leucine-rich repeat 146..168 CDD:275380 6/21 (29%)
PPP1R42 <169..271 CDD:455733 34/103 (33%)
leucine-rich repeat 169..190 CDD:275380 5/20 (25%)
leucine-rich repeat 191..212 CDD:275380 7/22 (32%)
leucine-rich repeat 213..237 CDD:275380 8/23 (35%)
U2AXP_308200.4 None

Return to query results.
Submit another query.