DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and Dnal1

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_083097.2 Gene:Dnal1 / 105000 MGIID:1921462 Length:190 Species:Mus musculus


Alignment Length:197 Identity:45/197 - (22%)
Similarity:80/197 - (40%) Gaps:26/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRL---QSLDLSGSVLSSLRDLGYGL 166
            |:.|.|.|..::|..:..:...:::.:....:.::...|..|   :.|.||.:.:..:.:|.   
Mouse     6 TIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIANLN--- 67

  Fly   167 LQLTRLDISNCGLNSFDGTSGLPAI----RVLIADGNMIQRVDPLAELVHLRVLKARNNRISELG 227
             .|..|.|.:.|.|:....:||.|:    ..|....|.|:::..:..:..|::|...||.:.:..
Mouse    68 -GLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWA 131

  Fly   228 LLSFLGMCPQLQEVELQGNPVCRLPLYRSL-------LARSVPTLQLLDGRVLNGEPAPVEMEEA 285
            ....|...|.|:::...|||   |....|.       ..:.||.|:.||     |.|...|.||.
Mouse   132 EFLKLAELPCLEDLVFVGNP---LEEKHSAEGNWIDEATKRVPKLKKLD-----GTPVIKEDEEE 188

  Fly   286 TS 287
            .|
Mouse   189 ES 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 15/63 (24%)
leucine-rich repeat 146..168 CDD:275380 5/24 (21%)
LRR_4 168..209 CDD:289563 11/44 (25%)
leucine-rich repeat 169..190 CDD:275380 7/20 (35%)
leucine-rich repeat 191..212 CDD:275380 3/24 (13%)
leucine-rich repeat 213..237 CDD:275380 5/23 (22%)
Dnal1NP_083097.2 LRR_4 49..89 CDD:289563 10/43 (23%)
LRR 1 49..70 4/24 (17%)
leucine-rich repeat 50..71 CDD:275378 5/24 (21%)
LRR_8 70..127 CDD:290566 14/56 (25%)
LRR 2 71..92 7/20 (35%)
leucine-rich repeat 72..90 CDD:275378 6/17 (35%)
LRR 3 94..115 3/20 (15%)
LRR_4 95..133 CDD:289563 7/37 (19%)
leucine-rich repeat 95..116 CDD:275382 3/20 (15%)
LRR 4 116..137 4/20 (20%)
leucine-rich repeat 117..140 CDD:275382 5/22 (23%)
leucine-rich repeat 142..172 CDD:275382 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.