Sequence 1: | NP_649175.1 | Gene: | CG14185 / 40197 | FlyBaseID: | FBgn0036936 | Length: | 402 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083097.2 | Gene: | Dnal1 / 105000 | MGIID: | 1921462 | Length: | 190 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 45/197 - (22%) |
---|---|---|---|
Similarity: | 80/197 - (40%) | Gaps: | 26/197 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 TLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRL---QSLDLSGSVLSSLRDLGYGL 166
Fly 167 LQLTRLDISNCGLNSFDGTSGLPAI----RVLIADGNMIQRVDPLAELVHLRVLKARNNRISELG 227
Fly 228 LLSFLGMCPQLQEVELQGNPVCRLPLYRSL-------LARSVPTLQLLDGRVLNGEPAPVEMEEA 285
Fly 286 TS 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14185 | NP_649175.1 | LRR_8 | 144..201 | CDD:290566 | 15/63 (24%) |
leucine-rich repeat | 146..168 | CDD:275380 | 5/24 (21%) | ||
LRR_4 | 168..209 | CDD:289563 | 11/44 (25%) | ||
leucine-rich repeat | 169..190 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 191..212 | CDD:275380 | 3/24 (13%) | ||
leucine-rich repeat | 213..237 | CDD:275380 | 5/23 (22%) | ||
Dnal1 | NP_083097.2 | LRR_4 | 49..89 | CDD:289563 | 10/43 (23%) |
LRR 1 | 49..70 | 4/24 (17%) | |||
leucine-rich repeat | 50..71 | CDD:275378 | 5/24 (21%) | ||
LRR_8 | 70..127 | CDD:290566 | 14/56 (25%) | ||
LRR 2 | 71..92 | 7/20 (35%) | |||
leucine-rich repeat | 72..90 | CDD:275378 | 6/17 (35%) | ||
LRR 3 | 94..115 | 3/20 (15%) | |||
LRR_4 | 95..133 | CDD:289563 | 7/37 (19%) | ||
leucine-rich repeat | 95..116 | CDD:275382 | 3/20 (15%) | ||
LRR 4 | 116..137 | 4/20 (20%) | |||
leucine-rich repeat | 117..140 | CDD:275382 | 5/22 (23%) | ||
leucine-rich repeat | 142..172 | CDD:275382 | 7/32 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |