DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14185 and drc3

DIOPT Version :9

Sequence 1:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001123832.1 Gene:drc3 / 100170587 XenbaseID:XB-GENE-1003585 Length:522 Species:Xenopus tropicalis


Alignment Length:183 Identity:49/183 - (26%)
Similarity:83/183 - (45%) Gaps:5/183 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LLPVVLPQQGPEPTLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLDLSGSVL 156
            :|...:.:|||:.....:.:  .:..|.:.|..:||. ....:.:..|..| ..|..|.|..:::
 Frog    17 MLRNAVEEQGPKEEAGRIAK--LEGIDFKHVSSLRLD-FKNILKIDNLWQF-HSLTKLQLDNNII 77

  Fly   157 SSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNN 221
            ..:..|. .|:.|..||:|...:...:|...|..:..|....|.|..|:.:..|.:|:||...||
 Frog    78 EKISGLD-TLVHLVWLDLSFNNIEVIEGLKALTKLEDLSLYNNRISVVENMDTLSNLQVLSLGNN 141

  Fly   222 RISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRVLN 274
            .::.|..|.:|....||:.:.|.|||:.....|:..:|..:|.|..||.|:||
 Frog   142 NLTSLENLIYLRKFKQLRTLSLAGNPLSEDDQYKLFIAAHLPNLAYLDFRLLN 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 13/56 (23%)
leucine-rich repeat 146..168 CDD:275380 5/21 (24%)
LRR_4 168..209 CDD:289563 10/40 (25%)
leucine-rich repeat 169..190 CDD:275380 6/20 (30%)
leucine-rich repeat 191..212 CDD:275380 5/20 (25%)
leucine-rich repeat 213..237 CDD:275380 8/23 (35%)
drc3NP_001123832.1 leucine-rich repeat 47..66 CDD:275380 4/20 (20%)
LRR_RI <60..211 CDD:238064 41/137 (30%)
leucine-rich repeat 67..88 CDD:275378 5/21 (24%)
LRR_8 88..143 CDD:290566 16/54 (30%)
leucine-rich repeat 89..110 CDD:275378 6/20 (30%)
LRR_4 109..149 CDD:289563 11/39 (28%)
leucine-rich repeat 111..132 CDD:275378 5/20 (25%)
leucine-rich repeat 133..157 CDD:275378 8/23 (35%)
leucine-rich repeat 158..169 CDD:275378 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.