DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and Cmklr1

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_071554.2 Gene:Cmklr1 / 60669 RGDID:69359 Length:372 Species:Rattus norvegicus


Alignment Length:364 Identity:93/364 - (25%)
Similarity:159/364 - (43%) Gaps:74/364 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GIIHNQFVQIFFYVLYATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPF 119
            |.:..:..::|..|:|:.|..||:.||.|| .|:...:..:||..::..|||::|.|..:. :|.
  Rat    30 GPLEAKVAEVFLVVIYSLVCFLGILGNGLV-IVIATFKMKKTVNTVWFVNLAVADFLFNIF-LPI 92

  Fly   120 TPLYTFMG-RWAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPF----HPRMKLS--T 177
            ...|..|. .|.||:::|.:.||....::|.|...||.|:.||...::.|.    |..::|:  |
  Rat    93 HITYAAMDYHWVFGKAMCKISSFLLSHNMYTSVFLLTVISFDRCISVLLPVWSQNHRSVRLAYMT 157

  Fly   178 CIGIIVSIWVIALLATVPYGMYMKMTNELVNGTQTGNETLVEATLMLNGSFVAQGSGFIEAPDST 242
            |    |.:||:|...:.| .:..:.|....:|         :.|...|.|        :.||:..
  Rat   158 C----VVVWVLAFFLSSP-SLVFRDTVSTSHG---------KITCFNNFS--------LAAPEPF 200

  Fly   243 SATQAYMQVMTAGSTGPEMPYVRVYCEENWPSEQYRKVFGAITTT---LQFVLPFFIISICYVWI 304
            |           .||.|...          |....|.|  |:|.|   ..|::|.|||:.||:.|
  Rat   201 S-----------HSTHPRTD----------PVGYSRHV--AVTVTRFLCGFLIPVFIITACYLTI 242

  Fly   305 SVKLNQRARAKPGSKSSRREEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDDFDDKSNEWR 369
            ..||.:...||               .|:..:::|.::..|.|.|.|.:.:.:. :....:....
  Rat   243 VFKLQRNRLAK---------------TKKPFKIIITIIITFFLCWCPYHTLYLL-ELHHTAVPAS 291

  Fly   370 FYILFFFVAHSIAMSSTCYNPFLYAWLNENFRKEFKHVL 408
            .:.|...:|.::|::::|.||.||.::..:|:| ||..|
  Rat   292 VFSLGLPLATAVAIANSCMNPILYVFMGHDFKK-FKVAL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 39/127 (31%)
7tm_1 80..393 CDD:278431 79/322 (25%)
Cmklr1NP_071554.2 7tm_1 55..315 CDD:278431 79/322 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.