DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and NPY5R

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:XP_011530317.1 Gene:NPY5R / 4889 HGNCID:7958 Length:452 Species:Homo sapiens


Alignment Length:493 Identity:108/493 - (21%)
Similarity:183/493 - (37%) Gaps:167/493 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NWSLTSPGTTSA-------ILADVAASDEDRSGGIIHNQFVQIFFYVLYATVFVLGVFGNVLVCY 86
            |.:|.:...|:|       :..|..:|.:|          :|.|...||..|.:||..||:|:..
Human    17 NKTLATENNTAATRNSDFPVWDDYKSSVDD----------LQYFLIGLYTFVSLLGFMGNLLILM 71

  Fly    87 VVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGRWAFGRSLCHLVSFAQGCSIYIST 151
            .:::.|..:|..|..|.|||.||||:.:...|||.....:.:|.||:.:||::.|.|..|:.:||
Human    72 ALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVST 136

  Fly   152 LTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVIALLATVPYGMYMKMTNELVNGTQTGNET 216
            |.|.||||.||.:|.:|....:..:....:|.::|.:......|..::               .:
Human   137 LILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVF---------------HS 186

  Fly   217 LVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQVMTAGSTGPEMPYVRVYCEENWPSEQYRKVF 281
            |||    |..:|   ||..:.:                          |..|.|:|||:.||..|
Human   187 LVE----LQETF---GSALLSS--------------------------RYLCVESWPSDSYRIAF 218

  Fly   282 GAITTTLQFVLPFFIISICYV---------------------WISVKLNQRARAKP-----GS-- 318
            ......:|::||...:::.:.                     .|::.|:...::.|     ||  
Human   219 TISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHK 283

  Fly   319 ------KSSRR------------------------------------------------------ 323
                  |..||                                                      
Human   284 WSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKP 348

  Fly   324 -EEADRDR----------KKRTNRM---LIAMVAVFGLSWLPINVVNIFDDFDDKSNEWRFYILF 374
             |.:|...          |||:..:   |..::.||.:||:|:::.::..||:|.....|.:.|.
Human   349 EENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLV 413

  Fly   375 FFVAHSIAMSSTCYNPFLYAWLNENFRKEFKHVLPCFN 412
            :.:.|.:.|.|.|.||.||.:||...:.:...::.|.:
Human   414 YCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLH 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 41/120 (34%)
7tm_1 80..393 CDD:278431 89/414 (21%)
NPY5RXP_011530317.1 7tm_4 56..>178 CDD:304433 42/121 (35%)
7tm_1 65..432 CDD:278431 89/414 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.