DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and TkR86C

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:505 Identity:111/505 - (21%)
Similarity:195/505 - (38%) Gaps:156/505 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LYATVFVLGVF----GNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGRW 129
            ::|.:|.|.:|    ||.:|.::|..:|:|:||||.|:.||:::|:|:..|...|..::.....|
  Fly    85 IWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSDW 149

  Fly   130 AFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVIALLATV 194
            .||...|.:.:|....::..|..||.:|:.|||..|::|...|........|:|.||.::.:.:.
  Fly   150 PFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRIILVLIWALSCVLSA 214

  Fly   195 PYGMYMK-MTNELVNGTQTGNETLVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQVMTAGSTG 258
            |..:|.. ||....||..                                               
  Fly   215 PCLLYSSIMTKHYYNGKS----------------------------------------------- 232

  Fly   259 PEMPYVRVYCEENWPSEQYRK-----VFGAITTTLQFVLPFFIISICY------VWISVKLNQRA 312
                  |..|...||..:|..     .:..|...|.:.:|..::.|||      :|.|..:    
  Fly   233 ------RTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLICYSLMGRVLWGSRSI---- 287

  Fly   313 RAKPGSKSSRREEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDDFDDKSNEWRF----YIL 373
                |..:.|:.|:.:. |::..||.||:|::|.:.|||.::..|:...:::....::    |:.
  Fly   288 ----GENTDRQMESMKS-KRKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQVASTKYVQHMYLG 347

  Fly   374 FFFVAHSIAMSSTCYNPFLYAWLNENFRKEFKHVLPC---------FNPSNNNIINITRGYNRSD 429
            |::    :|||:...||.:|.|:|:.||..|:.::.|         |:...:.:.|    .|.|:
  Fly   348 FYW----LAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGLTRHRFDSPKSRLTN----KNSSN 404

  Fly   430 RNTCGPRLHHGKGDGGMGGGSLDADDQDENGITQETCL-----------PKEKLLIIPREPTYGN 483
            |:|             .||.::.....:.:..|.:|.|           |:.:||:         
  Fly   405 RHT-------------RGGYTVAHSLPNSSPPTTQTLLAVLAQTLTQPKPQTQLLL--------- 447

  Fly   484 GTGAVSPILSGRGINAALVHGGDHQMHQLQPSHHQQVELTRRIRRRTDET 533
                                 ..|..|..|||   ..|...:.:|.|.||
  Fly   448 ---------------------SHHSPHPTQPS---AAETKSQWKRSTMET 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 38/124 (31%)
7tm_1 80..393 CDD:278431 76/328 (23%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 84/349 (24%)
7tm_1 100..363 CDD:278431 76/328 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.