DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and Gpr165

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001100052.1 Gene:Gpr165 / 296866 RGDID:1564566 Length:462 Species:Rattus norvegicus


Alignment Length:426 Identity:102/426 - (23%)
Similarity:190/426 - (44%) Gaps:101/426 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ITTTSSSISTSQLPLVSTTNWSLTSPGTTSAI-----LADVAASD---EDRSGG-----IIHNQF 61
            ||:|:|.:    |...|....::...|....:     |||..::.   .|.||.     :..::.
  Rat    40 ITSTTSQV----LQAASNAASAVGHAGRNGMLSKMDKLADHMSNTGDLADTSGPLDLEIVSQDEQ 100

  Fly    62 VQIFFYVLYATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFM 126
            ||.:..|.|..|....:.||.::.:::::.:.:.|.|.:|:.|:::::::|.:|:.|||.:....
  Rat   101 VQFWLVVGYTIVVFAAIIGNWVLNHIIMKYKRVHTATGLFVVNISVTNMMLALLSSPFTMVRYLC 165

  Fly   127 GRWAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPR---MKLSTCIGIIVSIWVI 188
            ....||:..|||..|||....|::.:::.:|::||:.|::||...|   |:.:.|   |:.||::
  Rat   166 NSLVFGKMTCHLSRFAQYSCAYVTVMSMAAISLDRHRVMLYPLKARITPMQGNVC---IIIIWIV 227

  Fly   189 ALLATVPYGMYMKMTNELVNGTQTGNETLVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQVMT 253
            :..|.:|:.:|.|:..     .:.||.|...|.|                               
  Rat   228 STCAALPHAVYQKLYQ-----VEFGNTTEESACL------------------------------- 256

  Fly   254 AGSTGPEMPYVRVYCEENWPSEQYRKVFGAITTTLQFVLPFFIISICY------VWI-----SVK 307
                 |..||.   .:..|      |.....|..|.|:||..::...|      :||     .:.
  Rat   257 -----PSFPYT---SKSTW------KYLDLGTFLLFFILPLLVLVAVYGHVAKKLWIHDAVDDIN 307

  Fly   308 LNQRARAKPGSKSSRREEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDDFDDKSNEWRFYI 372
            ::...             ..|.:||:|.:||:.:|.::.:||||:|:..:....:..|:....| 
  Rat   308 IHTYI-------------CQRGKKKQTLKMLMTVVLLYTISWLPLNLYLVLLSSESISSHNGLY- 358

  Fly   373 LFFFVAHSIAMSSTCYNPFLYAWLNENFRKEFKHVL 408
               |..|.:|:||:||||::|.||:::||.|.:.|:
  Rat   359 ---FFLHWLAISSSCYNPYIYCWLSDSFRIEVQKVI 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 33/123 (27%)
7tm_1 80..393 CDD:278431 77/326 (24%)
Gpr165NP_001100052.1 7tmA_GPR83 103..387 CDD:320511 85/353 (24%)
TM helix 1 105..129 CDD:320511 5/23 (22%)
TM helix 2 138..160 CDD:320511 6/21 (29%)
TM helix 3 176..198 CDD:320511 7/21 (33%)
TM helix 4 219..235 CDD:320511 5/18 (28%)
TM helix 5 268..291 CDD:320511 6/22 (27%)
TM helix 6 322..344 CDD:320511 8/21 (38%)
TM helix 7 355..380 CDD:320511 12/28 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.