DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and Fpr1

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001099686.1 Gene:Fpr1 / 292409 RGDID:1310883 Length:355 Species:Rattus norvegicus


Alignment Length:375 Identity:93/375 - (24%)
Similarity:155/375 - (41%) Gaps:74/375 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DVAASDEDRSGGIIHNQFVQIFFYVLYATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALS 108
            :::.|....|.|.|   .:.||.|:::|..|||||.||.||.:|. ..|..:|||.|...|||::
  Rat    12 NMSGSTRSVSAGYI---VLDIFSYLIFALTFVLGVLGNGLVIWVA-GFRMKRTVTTISYLNLAIA 72

  Fly   109 DILLCVLA-VPFTPLYTFMGR-WAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPF-- 169
            |  .|..: :||..:...||. |.||..:|..:......:::.|...:..||:||...:::|.  
  Rat    73 D--FCFTSTLPFYIVSLVMGGIWPFGWFMCKFIYTVIDINLFGSVFLIALIALDRCVCVLHPVWA 135

  Fly   170 --HPRMKLSTCIGIIVSIWVIALLATVPYGMYMKMTNELVNGTQTGNETLVEATLMLNGSFVAQG 232
              |..:.|:.  .:|:..|:.|.|.|:|                    .::..|.:.|..     
  Rat   136 QNHRTVTLAK--KVIIVPWICAFLLTLP--------------------VIIRVTTVPNRL----- 173

  Fly   233 SGFIEAPDSTSATQAYMQVMTAGSTGPEMPYVRVYCEENWPSEQYRKVFGAITTTLQFVLPFFII 297
                 .|..|:....:            .|:.:...|::..:.....|.|.|...|.|..|..|:
  Rat   174 -----GPGKTACALDF------------SPWTKDRAEKDKVAITMYTVRGIIRFILGFSTPMSIV 221

  Fly   298 SICYVWISVKLNQRARAKPGSKSSRREEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDDFD 362
            :|||..|:.|::::...|               ..|..|:|..:||.|.|.|.|..||.:.....
  Rat   222 AICYGLIATKIHRQGLIK---------------SSRPLRVLSFVVAAFFLCWCPFQVVGLIRTIQ 271

  Fly   363 DKS---NEWRFYILFFFVAHSIAMSSTCYNPFLYAWLNENFRKEFKHVLP 409
            .:.   |..:..:....:..|:|..::|.||.||.::.::||:...|.||
  Rat   272 IREHLRNIPQSTLTAMKITSSLAFFNSCLNPILYVFMGQDFRQRLIHSLP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 40/126 (32%)
7tm_1 80..393 CDD:278431 73/321 (23%)
Fpr1NP_001099686.1 7tm_1 45..305 CDD:278431 73/321 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.