DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and GPR33

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001184113.2 Gene:GPR33 / 2856 HGNCID:4489 Length:333 Species:Homo sapiens


Alignment Length:357 Identity:78/357 - (21%)
Similarity:142/357 - (39%) Gaps:75/357 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFM-GRWAFGRSLCHL 138
            ::|...|.|..: |||.:..|||..:...:|.|| ..:..:.:||....... ..|.||.:||.:
Human    41 IIGTITNGLYLW-VLRFKMKQTVNTLLFFHLILS-YFISTMILPFMATSQLQDNHWNFGTALCKV 103

  Fly   139 VSFAQGCSIYISTLTLTSIAIDRYFVIIYPF----H--PRMKLSTCIGIIVSIWVIALLATVPYG 197
            .:......::.|...|::|.:|||.:.::|.    |  ||...|    |::.:|:.|...::||.
Human   104 FNGTLSLGMFTSVFFLSAIGLDRYLLTLHPVWSQQHRTPRWASS----IVLGVWISAAALSIPYL 164

  Fly   198 MYMKMTNELVNGTQTGNETLVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQVMTAGSTGPEMP 262
            ::.:..::                  ..|....|.:..:.....:...||..|            
Human   165 IFRETHHD------------------RKGKVTCQNNYAVSTNWESKEMQASRQ------------ 199

  Fly   263 YVRVYCEENWPSEQYRKVFGAITTTLQFVLPFFIISICYVWISVKLNQRARAKPGSKSSRREEAD 327
            ::.|.|        :...|     .|.|:||||||..||..::.|:.:|:..|            
Human   200 WIHVAC--------FISRF-----LLGFLLPFFIIIFCYERVASKVKERSLFK------------ 239

  Fly   328 RDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDDFDDKSNEWRFYILFFFVAHSIAMSSTCYNPFL 392
              ..|....|:.|:::.| :.|:|   .:|.......:|:.....|...:.......:|.::|.|
Human   240 --SSKPFKVMMTAIISFF-VCWMP---YHIHQGLLLTTNQSLLLELTLILTVLTTSFNTIFSPTL 298

  Fly   393 YAWLNENFRKEF-KHVLPCFNPSNNNIINITR 423
            |.::.|||:|.| |.:|..|..:.:...::.|
Human   299 YLFVGENFKKVFKKSILALFESTFSEDSSVER 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 33/127 (26%)
7tm_1 80..393 CDD:278431 66/319 (21%)
GPR33NP_001184113.2 7tm_1 47..265 CDD:278431 62/284 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.